Gene Information

Name : Haur_0804 (Haur_0804)
Accession : YP_001543580.1
Strain : Herpetosiphon aurantiacus DSM 785
Genome accession: NC_009972
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 908797 - 909507 bp
Length : 711 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: rca:Rcas_0997 two component transcriptional regulator, winged helix family

DNA sequence :
ATGTCCACAATATTGCTTGTAGAAGATGAAGCCCTGCTCGCCGATACGCTCCGTTACAACCTTGAACGCGAAGGCTACAC
CGTGCTTTCTGCTTCCGATGGAGTTACCGGGCTGGATTTAGCCCGCGCCGAACAGCCCGATTTGCTGATTTTAGATGTGA
TGTTGCCCAAACTCGACGGCTTTTCAGTCTGTCGAATTTTACGGCGTGAAACCAATATCCCGATTATGATGCTGACTGCC
CGCCAAGATGAAGTTGATCGGATCGCTGGCTTGGAATTGGGCGCTGATGATTATGTGATTAAGCCATTTAGCCTTGGTGA
ATTACTGGCCCGCGTTCGAGCGATTTTGCGTCGTACCGACCGCCAACCAACCGGAGTTGAACGCGAATTGCTGACCGCCG
CCAATCTTAAGGTCGATACTGGCAGTCGTCGGGTGTTTCGTGATAACAACGAAATTACGCTCGCTCAGAAGGAATTCGAC
TTGTTGGTGTGTTTGATGCGCAACCGTGGCATGGCGCTTTCGCGCGATTTGCTGCTCGAACGAGTTTGGGGTTACGATTT
TCCAGGCGATTCGCGCACGGTCGATGTGCATGTGCGTTGGCTGCGTGAGAAAGTTGAAGTAGACCCCAGCAACCCAATTT
ATATTCAAACTGTGCGTGGGATTGGCTATCGTTTTAATGATCAACTTAGCCGTAGCGAGCGCAAAAACTAA

Protein sequence :
MSTILLVEDEALLADTLRYNLEREGYTVLSASDGVTGLDLARAEQPDLLILDVMLPKLDGFSVCRILRRETNIPIMMLTA
RQDEVDRIAGLELGADDYVIKPFSLGELLARVRAILRRTDRQPTGVERELLTAANLKVDTGSRRVFRDNNEITLAQKEFD
LLVCLMRNRGMALSRDLLLERVWGYDFPGDSRTVDVHVRWLREKVEVDPSNPIYIQTVRGIGYRFNDQLSRSERKN

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-34 44
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-34 44
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 2e-38 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 8e-38 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Haur_0804 YP_001543580.1 two component transcriptional regulator AE000516.2.gene3505. Protein 2e-45 49
Haur_0804 YP_001543580.1 two component transcriptional regulator AE016830.1.gene1681. Protein 1e-53 47
Haur_0804 YP_001543580.1 two component transcriptional regulator HE999704.1.gene2815. Protein 3e-51 47
Haur_0804 YP_001543580.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 6e-50 47
Haur_0804 YP_001543580.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 4e-50 47
Haur_0804 YP_001543580.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 5e-50 47
Haur_0804 YP_001543580.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 4e-50 47
Haur_0804 YP_001543580.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 4e-50 47
Haur_0804 YP_001543580.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 4e-50 47
Haur_0804 YP_001543580.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 3e-50 47
Haur_0804 YP_001543580.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 4e-50 47
Haur_0804 YP_001543580.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 4e-50 47
Haur_0804 YP_001543580.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 4e-50 47
Haur_0804 YP_001543580.1 two component transcriptional regulator BAC0197 Protein 2e-38 47
Haur_0804 YP_001543580.1 two component transcriptional regulator BAC0125 Protein 7e-41 46
Haur_0804 YP_001543580.1 two component transcriptional regulator HE999704.1.gene1528. Protein 1e-41 46
Haur_0804 YP_001543580.1 two component transcriptional regulator NC_012469.1.7686381. Protein 7e-52 46
Haur_0804 YP_001543580.1 two component transcriptional regulator NC_012469.1.7685629. Protein 2e-48 46
Haur_0804 YP_001543580.1 two component transcriptional regulator BAC0308 Protein 8e-34 44
Haur_0804 YP_001543580.1 two component transcriptional regulator CP000675.2.gene1535. Protein 3e-37 43
Haur_0804 YP_001543580.1 two component transcriptional regulator BAC0347 Protein 1e-36 43
Haur_0804 YP_001543580.1 two component transcriptional regulator BAC0111 Protein 2e-38 43
Haur_0804 YP_001543580.1 two component transcriptional regulator BAC0638 Protein 6e-31 43
Haur_0804 YP_001543580.1 two component transcriptional regulator CP000034.1.gene3671. Protein 1e-38 43
Haur_0804 YP_001543580.1 two component transcriptional regulator AE015929.1.gene1106. Protein 3e-37 42
Haur_0804 YP_001543580.1 two component transcriptional regulator NC_002952.2859858.p0 Protein 3e-40 42
Haur_0804 YP_001543580.1 two component transcriptional regulator NC_007622.3794948.p0 Protein 3e-40 42
Haur_0804 YP_001543580.1 two component transcriptional regulator NC_003923.1003417.p0 Protein 3e-40 42
Haur_0804 YP_001543580.1 two component transcriptional regulator NC_013450.8614146.p0 Protein 3e-40 42
Haur_0804 YP_001543580.1 two component transcriptional regulator NC_002951.3238224.p0 Protein 3e-40 42
Haur_0804 YP_001543580.1 two component transcriptional regulator NC_007793.3914065.p0 Protein 3e-40 42
Haur_0804 YP_001543580.1 two component transcriptional regulator NC_002758.1121390.p0 Protein 3e-40 42
Haur_0804 YP_001543580.1 two component transcriptional regulator NC_010079.5776364.p0 Protein 3e-40 42
Haur_0804 YP_001543580.1 two component transcriptional regulator BAC0083 Protein 2e-35 42
Haur_0804 YP_001543580.1 two component transcriptional regulator AF155139.2.orf0.gene Protein 2e-37 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Haur_0804 YP_001543580.1 two component transcriptional regulator VFG1390 Protein 9e-43 46
Haur_0804 YP_001543580.1 two component transcriptional regulator VFG0596 Protein 5e-35 44
Haur_0804 YP_001543580.1 two component transcriptional regulator VFG1389 Protein 3e-36 44
Haur_0804 YP_001543580.1 two component transcriptional regulator VFG1386 Protein 4e-38 42
Haur_0804 YP_001543580.1 two component transcriptional regulator VFG1563 Protein 1e-38 41
Haur_0804 YP_001543580.1 two component transcriptional regulator VFG1702 Protein 3e-38 41