Gene Information

Name : Dole_1930 (Dole_1930)
Accession : YP_001529811.1
Strain : Desulfococcus oleovorans Hxd3
Genome accession: NC_009943
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2330942 - 2331643 bp
Length : 702 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: pca:Pcar_0653 response regulator receiver domain protein (CheY-like)

DNA sequence :
ATGGCAAAAGAAAAAATCCTGATCGTGGATGATGAAAAAGACATCCTCGAGCTGCTTCGGCTCAGCCTGGAACGGGACGG
CTACCAGGTGGCGTGCGCGGAATCCGGGGAAAAGGCCCTGGAAATTGTTTTATCCGGCCGGCCGGACCTGGTGGTGCTGG
ACCTGATGCTGCCGGGCATCGACGGTCTTGAAGTGGCCAGGGCGATTCGAAACGACGACCGGATACAGGGGACCCCGATT
TTGATGCTGTCGGCAAAAGGGGAAGAGTCGGACATTATCACCGGCCTTGAACTGGGGGCTGACGACTACATCACCAAGCC
CTTTTCCCCGAAAATACTGATTGCCCGCATTCGCTCTGTTTTACGAAGGCAGCAGGCAAAAGCCGCGCCACCGGACCCCG
GCCGGACCATCGCCGTTTCCGGCATCACCATCCATCCCCGGAAACACACCGTGGAAGTGAATGGGAAAAAAATTGACCTG
ACCCCGTCGGAATTTGATATCCTGTCTTTTCTTGCTTCCCGGCCCGGGCTGGTGTTCACCCGATGGCAGATCGTGGACAA
GATCCGTGGAGAGCACTACGCCGTCACCGACAGAAGCGTGGATGTACTGATCTCCGGGCTTCGAAAGAAACTGGAGGATT
ACGGCGAATATATCGAAACAGTCCGCGGCGTGGGGTACCGGTTCAGGGAAATCGAGGAATGA

Protein sequence :
MAKEKILIVDDEKDILELLRLSLERDGYQVACAESGEKALEIVLSGRPDLVVLDLMLPGIDGLEVARAIRNDDRIQGTPI
LMLSAKGEESDIITGLELGADDYITKPFSPKILIARIRSVLRRQQAKAAPPDPGRTIAVSGITIHPRKHTVEVNGKKIDL
TPSEFDILSFLASRPGLVFTRWQIVDKIRGEHYAVTDRSVDVLISGLRKKLEDYGEYIETVRGVGYRFREIEE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 5e-35 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-35 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Dole_1930 YP_001529811.1 two component transcriptional regulator HE999704.1.gene2815. Protein 6e-45 46
Dole_1930 YP_001529811.1 two component transcriptional regulator NC_002951.3238224.p0 Protein 3e-37 45
Dole_1930 YP_001529811.1 two component transcriptional regulator NC_007793.3914065.p0 Protein 3e-37 45
Dole_1930 YP_001529811.1 two component transcriptional regulator NC_002758.1121390.p0 Protein 3e-37 45
Dole_1930 YP_001529811.1 two component transcriptional regulator NC_010079.5776364.p0 Protein 3e-37 45
Dole_1930 YP_001529811.1 two component transcriptional regulator NC_002952.2859858.p0 Protein 3e-37 45
Dole_1930 YP_001529811.1 two component transcriptional regulator NC_007622.3794948.p0 Protein 3e-37 45
Dole_1930 YP_001529811.1 two component transcriptional regulator NC_003923.1003417.p0 Protein 3e-37 45
Dole_1930 YP_001529811.1 two component transcriptional regulator NC_013450.8614146.p0 Protein 3e-37 45
Dole_1930 YP_001529811.1 two component transcriptional regulator NC_012469.1.7685629. Protein 1e-39 45
Dole_1930 YP_001529811.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 5e-41 44
Dole_1930 YP_001529811.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 4e-41 44
Dole_1930 YP_001529811.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 3e-41 44
Dole_1930 YP_001529811.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 3e-41 44
Dole_1930 YP_001529811.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 3e-41 44
Dole_1930 YP_001529811.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 2e-41 44
Dole_1930 YP_001529811.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 3e-41 44
Dole_1930 YP_001529811.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 3e-41 44
Dole_1930 YP_001529811.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 3e-41 44
Dole_1930 YP_001529811.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 3e-41 44
Dole_1930 YP_001529811.1 two component transcriptional regulator AE016830.1.gene1681. Protein 2e-42 43
Dole_1930 YP_001529811.1 two component transcriptional regulator AE000516.2.gene3505. Protein 4e-33 43
Dole_1930 YP_001529811.1 two component transcriptional regulator AE015929.1.gene1106. Protein 2e-31 42
Dole_1930 YP_001529811.1 two component transcriptional regulator CP000675.2.gene1535. Protein 1e-39 42
Dole_1930 YP_001529811.1 two component transcriptional regulator BAC0596 Protein 1e-32 42
Dole_1930 YP_001529811.1 two component transcriptional regulator CP001138.1.gene2239. Protein 1e-32 42
Dole_1930 YP_001529811.1 two component transcriptional regulator AF155139.2.orf0.gene Protein 6e-39 41
Dole_1930 YP_001529811.1 two component transcriptional regulator NC_014475.1.orf0.gen Protein 3e-33 41
Dole_1930 YP_001529811.1 two component transcriptional regulator NC_005054.2598277.p0 Protein 3e-33 41
Dole_1930 YP_001529811.1 two component transcriptional regulator CP001918.1.gene3444. Protein 2e-31 41
Dole_1930 YP_001529811.1 two component transcriptional regulator CP000034.1.gene3671. Protein 8e-34 41
Dole_1930 YP_001529811.1 two component transcriptional regulator CP000034.1.gene2186. Protein 2e-32 41
Dole_1930 YP_001529811.1 two component transcriptional regulator NC_002695.1.916589.p Protein 2e-32 41
Dole_1930 YP_001529811.1 two component transcriptional regulator CP000647.1.gene2531. Protein 3e-32 41
Dole_1930 YP_001529811.1 two component transcriptional regulator BAC0039 Protein 2e-32 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Dole_1930 YP_001529811.1 two component transcriptional regulator VFG1563 Protein 3e-35 41
Dole_1930 YP_001529811.1 two component transcriptional regulator VFG1702 Protein 8e-36 41