Gene Information

Name : fliQ (AZC_0653)
Accession : YP_001523569.1
Strain : Azorhizobium caulinodans ORS 571
Genome accession: NC_009937
Putative virulence/resistance : Virulence
Product : flagellar biosynthesis protein FliQ
Function : -
COG functional category : N : Cell motility
COG ID : COG1987
EC number : -
Position : 723308 - 723574 bp
Length : 267 bp
Strand : +
Note : FliQ, with proteins FliP and FliR, forms the core of the central channel in the flagella export apparatus; Bradyrhizobium have one thick flagellum and several thin flagella; the protein in this cluster is associated with the thick flagellum

DNA sequence :
ATGAACGAGGCCGACGCCCTCGACGTCGTCCGAAACGCCATCTGGACCATCCTGTTGGCGGCGGGGCCTGCGGTGGCGGC
GGCGATGCTGGTGGGCATCTTCATCGCCCTCATCCAGGCGCTCACGCAGATCCAGGAAGCGACCCTCACCTTCGTGCCGA
AGATCATCGCCGTGCTGGTGGTCTGCGCACTCACCGGGTCGTTCATGGGCAGCCAGATCATGGCTTTCACCGAAGAAATT
TACGGCCGCATCGCCAGCGGCTTCTGA

Protein sequence :
MNEADALDVVRNAIWTILLAAGPAVAAAMLVGIFIALIQALTQIQEATLTFVPKIIAVLVVCALTGSFMGSQIMAFTEEI
YGRIASGF

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
escS AAK26701.1 EscS Virulence LEE Protein 4e-05 44
escS AAL57528.1 EscS Virulence LEE Protein 4e-05 44
escS CAC81848.1 EscS protein Virulence LEE II Protein 4e-05 44
escS YP_003223489.1 T3SS structure protein EscS Virulence LEE Protein 6e-05 44
unnamed AAL06355.1 EscS Virulence LEE Protein 3e-05 44
escS YP_003232139.1 T3SS structure protein EscS Virulence LEE Protein 6e-05 44
escS CAI43888.1 EscS protein Virulence LEE Protein 4e-05 43
escS YP_003236102.1 T3SS structure protein EscS Virulence LEE Protein 9e-05 43
escS NP_290282.1 hypothetical protein Virulence LEE Protein 9e-05 43
ECs4582 NP_312609.1 EscS Virulence LEE Protein 9e-05 43
escS AAC38370.1 EscS Virulence LEE Protein 6e-05 43
escS AAC31527.1 L0048 Virulence LEE Protein 6e-05 43
escS ACU09472.1 hypothetical protein Not tested LEE Protein 6e-05 43

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
fliQ YP_001523569.1 flagellar biosynthesis protein FliQ VFG0395 Protein 6e-06 43
fliQ YP_001523569.1 flagellar biosynthesis protein FliQ VFG0187 Protein 0.021 43
fliQ YP_001523569.1 flagellar biosynthesis protein FliQ VFG0716 Protein 3e-05 43
fliQ YP_001523569.1 flagellar biosynthesis protein FliQ VFG0826 Protein 3e-05 43