
|
Name : fliQ (AZC_0653) Accession : YP_001523569.1 Strain : Azorhizobium caulinodans ORS 571 Genome accession: NC_009937 Putative virulence/resistance : Virulence Product : flagellar biosynthesis protein FliQ Function : - COG functional category : N : Cell motility COG ID : COG1987 EC number : - Position : 723308 - 723574 bp Length : 267 bp Strand : + Note : FliQ, with proteins FliP and FliR, forms the core of the central channel in the flagella export apparatus; Bradyrhizobium have one thick flagellum and several thin flagella; the protein in this cluster is associated with the thick flagellum DNA sequence : ATGAACGAGGCCGACGCCCTCGACGTCGTCCGAAACGCCATCTGGACCATCCTGTTGGCGGCGGGGCCTGCGGTGGCGGC GGCGATGCTGGTGGGCATCTTCATCGCCCTCATCCAGGCGCTCACGCAGATCCAGGAAGCGACCCTCACCTTCGTGCCGA AGATCATCGCCGTGCTGGTGGTCTGCGCACTCACCGGGTCGTTCATGGGCAGCCAGATCATGGCTTTCACCGAAGAAATT TACGGCCGCATCGCCAGCGGCTTCTGA Protein sequence : MNEADALDVVRNAIWTILLAAGPAVAAAMLVGIFIALIQALTQIQEATLTFVPKIIAVLVVCALTGSFMGSQIMAFTEEI YGRIASGF |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| escS | AAK26701.1 | EscS | Virulence | LEE | Protein | 4e-05 | 44 |
| escS | AAL57528.1 | EscS | Virulence | LEE | Protein | 4e-05 | 44 |
| escS | CAC81848.1 | EscS protein | Virulence | LEE II | Protein | 4e-05 | 44 |
| escS | YP_003223489.1 | T3SS structure protein EscS | Virulence | LEE | Protein | 6e-05 | 44 |
| unnamed | AAL06355.1 | EscS | Virulence | LEE | Protein | 3e-05 | 44 |
| escS | YP_003232139.1 | T3SS structure protein EscS | Virulence | LEE | Protein | 6e-05 | 44 |
| escS | ACU09472.1 | hypothetical protein | Not tested | LEE | Protein | 6e-05 | 43 |
| escS | CAI43888.1 | EscS protein | Virulence | LEE | Protein | 4e-05 | 43 |
| escS | YP_003236102.1 | T3SS structure protein EscS | Virulence | LEE | Protein | 9e-05 | 43 |
| escS | NP_290282.1 | hypothetical protein | Virulence | LEE | Protein | 9e-05 | 43 |
| ECs4582 | NP_312609.1 | EscS | Virulence | LEE | Protein | 9e-05 | 43 |
| escS | AAC38370.1 | EscS | Virulence | LEE | Protein | 6e-05 | 43 |
| escS | AAC31527.1 | L0048 | Virulence | LEE | Protein | 6e-05 | 43 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| fliQ | YP_001523569.1 | flagellar biosynthesis protein FliQ | VFG0395 | Protein | 6e-06 | 43 |
| fliQ | YP_001523569.1 | flagellar biosynthesis protein FliQ | VFG0187 | Protein | 0.021 | 43 |
| fliQ | YP_001523569.1 | flagellar biosynthesis protein FliQ | VFG0826 | Protein | 3e-05 | 43 |
| fliQ | YP_001523569.1 | flagellar biosynthesis protein FliQ | VFG0716 | Protein | 3e-05 | 43 |