Gene Information

Name : AM1_5663 (AM1_5663)
Accession : YP_001519929.1
Strain : Acaryochloris marina MBIC11017
Genome accession: NC_009925
Putative virulence/resistance : Virulence
Product : two-component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 5727341 - 5728072 bp
Length : 732 bp
Strand : +
Note : -

DNA sequence :
TTGGAAAATCATAAAGAGAAAATTCTGGTGGTCGACGATGAAGCGAGTATTCGTCGCATCCTAGAAACACGCCTCTCCAT
GATTGGCTACGATGTCGTCACCGCCGCAGATGGAGAAGAAGCCATCGACACATTCCATCACGCCATTCCTGACTTAGTTG
TCCTTGATGTCATGATGCCAAAACTAGACGGCTATGGCGTCTGCCAAGAACTCCGCAAAGAATCCGACGTTCCCATTATT
ATGTTGACCGCCTTAGGGGATGTCGCTGATCGCATTACCGGTTTGGAACTCGGTGCAGATGACTATGTGGTTAAACCGTT
TTCACCGAAAGAATTAGAAGCTCGCATTCGCTCCGTGCTAAGGCGTGTGAGCAAAAATGGTAACTCTGGTATTCCCAGCT
CCGGGGTGATCAGTGTCCATACCTTGAAGATTGATACCAATAAGCGCCAGGTCTATAAGGGAGATGAGCGCATTCGGCTC
ACCGGCATGGAGTTTAGCCTGCTGGAATTATTGGTCAGTCGCTCCGGTGAAGCCTTCTCCCGCTCCGATATTTTGCAAGA
AGTTTGGGGTTATACCCCGGAACGCCATGTGGATACTCGGGTGGTGGATGTCCATATTTCTCGATTGAGAGCCAAACTGG
AAGAGGATCCCAGTAATCCTGAACTGATTTTGACCGCTAGAGGGACAGGGTATCTGTTTCAGCGAATTGTTGAGCCTGGG
GAAATGCCTTAA

Protein sequence :
MENHKEKILVVDDEASIRRILETRLSMIGYDVVTAADGEEAIDTFHHAIPDLVVLDVMMPKLDGYGVCQELRKESDVPII
MLTALGDVADRITGLELGADDYVVKPFSPKELEARIRSVLRRVSKNGNSGIPSSGVISVHTLKIDTNKRQVYKGDERIRL
TGMEFSLLELLVSRSGEAFSRSDILQEVWGYTPERHVDTRVVDVHISRLRAKLEEDPSNPELILTARGTGYLFQRIVEPG
EMP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 5e-31 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-30 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
AM1_5663 YP_001519929.1 two-component transcriptional regulator NC_002952.2859905.p0 Protein 2e-46 48
AM1_5663 YP_001519929.1 two-component transcriptional regulator NC_002745.1124361.p0 Protein 4e-46 48
AM1_5663 YP_001519929.1 two-component transcriptional regulator NC_009782.5559369.p0 Protein 4e-46 48
AM1_5663 YP_001519929.1 two-component transcriptional regulator NC_002951.3237708.p0 Protein 4e-46 48
AM1_5663 YP_001519929.1 two-component transcriptional regulator NC_003923.1003749.p0 Protein 3e-46 48
AM1_5663 YP_001519929.1 two-component transcriptional regulator NC_002758.1121668.p0 Protein 4e-46 48
AM1_5663 YP_001519929.1 two-component transcriptional regulator NC_007622.3794472.p0 Protein 2e-46 48
AM1_5663 YP_001519929.1 two-component transcriptional regulator NC_009641.5332272.p0 Protein 4e-46 48
AM1_5663 YP_001519929.1 two-component transcriptional regulator NC_013450.8614421.p0 Protein 4e-46 48
AM1_5663 YP_001519929.1 two-component transcriptional regulator NC_007793.3914279.p0 Protein 4e-46 48
AM1_5663 YP_001519929.1 two-component transcriptional regulator HE999704.1.gene2815. Protein 5e-41 46
AM1_5663 YP_001519929.1 two-component transcriptional regulator NC_012469.1.7685629. Protein 3e-42 45
AM1_5663 YP_001519929.1 two-component transcriptional regulator BAC0125 Protein 2e-38 44
AM1_5663 YP_001519929.1 two-component transcriptional regulator AE000516.2.gene3505. Protein 2e-42 44
AM1_5663 YP_001519929.1 two-component transcriptional regulator BAC0083 Protein 3e-36 43
AM1_5663 YP_001519929.1 two-component transcriptional regulator CP001918.1.gene5135. Protein 2e-26 43
AM1_5663 YP_001519929.1 two-component transcriptional regulator BAC0638 Protein 3e-28 42
AM1_5663 YP_001519929.1 two-component transcriptional regulator CP001138.1.gene4273. Protein 1e-29 42
AM1_5663 YP_001519929.1 two-component transcriptional regulator BAC0533 Protein 3e-30 42
AM1_5663 YP_001519929.1 two-component transcriptional regulator CP004022.1.gene3215. Protein 1e-34 42
AM1_5663 YP_001519929.1 two-component transcriptional regulator CP000647.1.gene4257. Protein 3e-30 42
AM1_5663 YP_001519929.1 two-component transcriptional regulator CP000034.1.gene3671. Protein 2e-38 42
AM1_5663 YP_001519929.1 two-component transcriptional regulator NC_007793.3914065.p0 Protein 5e-36 41
AM1_5663 YP_001519929.1 two-component transcriptional regulator NC_002758.1121390.p0 Protein 5e-36 41
AM1_5663 YP_001519929.1 two-component transcriptional regulator NC_010079.5776364.p0 Protein 5e-36 41
AM1_5663 YP_001519929.1 two-component transcriptional regulator NC_002952.2859858.p0 Protein 5e-36 41
AM1_5663 YP_001519929.1 two-component transcriptional regulator NC_007622.3794948.p0 Protein 5e-36 41
AM1_5663 YP_001519929.1 two-component transcriptional regulator NC_003923.1003417.p0 Protein 5e-36 41
AM1_5663 YP_001519929.1 two-component transcriptional regulator NC_013450.8614146.p0 Protein 5e-36 41
AM1_5663 YP_001519929.1 two-component transcriptional regulator NC_002951.3238224.p0 Protein 5e-36 41
AM1_5663 YP_001519929.1 two-component transcriptional regulator CP000675.2.gene1535. Protein 4e-39 41
AM1_5663 YP_001519929.1 two-component transcriptional regulator BAC0197 Protein 2e-33 41
AM1_5663 YP_001519929.1 two-component transcriptional regulator CP000034.1.gene3834. Protein 3e-29 41
AM1_5663 YP_001519929.1 two-component transcriptional regulator NC_002695.1.915041.p Protein 3e-29 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
AM1_5663 YP_001519929.1 two-component transcriptional regulator VFG1390 Protein 3e-39 44
AM1_5663 YP_001519929.1 two-component transcriptional regulator VFG1389 Protein 3e-33 43
AM1_5663 YP_001519929.1 two-component transcriptional regulator VFG0596 Protein 2e-31 42