Gene Information

Name : Clos_0699 (Clos_0699)
Accession : YP_001512254.1
Strain : Alkaliphilus oremlandii OhILAs
Genome accession: NC_009922
Putative virulence/resistance : Resistance
Product : stress protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 776085 - 776666 bp
Length : 582 bp
Strand : +
Note : PFAM: stress protein; KEGG: ctc:CTC02234 tellurium resistance protein terD

DNA sequence :
ATGGCGATTAGTTTAAGTAAAGGACAAAAAGTAGATTTAACAAAGGGCAATCCAGGGCTATCTAAAGTTGTGGTAGGTCT
TGGATGGGATACGAATAAATACGATGGTGGACACGCTTTTGACTTAGATGCAGCTGCGTTTCTATTGGGATCCAATGGAA
AGGTAAGTGACGATAATGATTTTATCTTCTACAACAATTTAAAAGATAAATCAGGCTCGATTACACATTTAGGTGATAAC
CTAACTGGTGAAGGAGACGGCGATGATGAGCAAGTAAGAATTGAGTTAGCCAATGTACCTGCAAGTATTGAGCGTATTGC
ATTTACTGTAACGATTCACCATGCTGAGGAACGTGCGCAAAACTTTGGACAGGTATCCAATGCTTTTATCCGTGTATTTA
AAGAAGACACTGGAGAAGAATTGATCCGATACGATCTAGGAGAGGACTTCAGCGTTGAGACGGCTTTAGTTGTAGGAGAA
CTATACCGCCACGGTGGGGAGTGGAAGTTTAGTGCAATTGGAAGTGGATTCCAAGGAGGATTGTATGCACTTTGTAGAAA
CTTTGGTGTAAATGTAGGATAA

Protein sequence :
MAISLSKGQKVDLTKGNPGLSKVVVGLGWDTNKYDGGHAFDLDAAAFLLGSNGKVSDDNDFIFYNNLKDKSGSITHLGDN
LTGEGDGDDEQVRIELANVPASIERIAFTVTIHHAEERAQNFGQVSNAFIRVFKEDTGEELIRYDLGEDFSVETALVVGE
LYRHGGEWKFSAIGSGFQGGLYALCRNFGVNVG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-46 58
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-46 58
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-42 57
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 8e-43 57
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 4e-46 57
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-42 57
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 7e-47 57
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 3e-42 56
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-23 41
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-23 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Clos_0699 YP_001512254.1 stress protein BAC0390 Protein 6e-44 57
Clos_0699 YP_001512254.1 stress protein BAC0389 Protein 3e-46 57