Gene Information

Name : Clos_2784 (Clos_2784)
Accession : YP_001514311.1
Strain : Alkaliphilus oremlandii OhILAs
Genome accession: NC_009922
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3027541 - 3028230 bp
Length : 690 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: csc:Csac_2559 two component transcriptional regulator, winged helix family

DNA sequence :
GTGGCAAAGAATATTTTGATTGTTGAGGATGAAAAACCGATTTCTGATATAGTAAGGTTTAACTTAGAGAAAGAGGGCTA
TAAGGTTTTGGTGGCTTATGATGGGGAGGACGGTGTCAATAAGGCGTTGACATTGAACCCAGATTTAGTGCTGCTAGACG
TGATGTTGCCTAAGCTGGATGGTTTTCAAGTATGTAGAAAAATTCGTGCAAGCTCTTCCGTACCAATTTTGATGCTGACA
GCGAAGGAAGAAGAAGTCGACAAGGTACTGGGTCTGGAAATGGGAGCCGATGATTATATTACCAAACCATTCGGTATGAG
AGAGCTTCTGGCTAGAGTCAAAGCCAACCTGAGAAGAACTGAAAGTGGTTCTGGAAGCAATCTGGAGGGAATATTTACAA
CAGGGGGAATCGTTATCGACTTTTCTAAGTATGAAGTAAGAAAGAATGATACGGTCATAGAGCTTACCTCTAGAGAATTT
GAACTTCTAAAATTTTTGGCCCTTCAGGCAGAGCAGGTATTTACTAGAGAACAGCTTTTAAAGCAGGTATGGGGATATGA
ATATTATGGCGATATTCGTACTGTAGACGTAACTGTAAGAAGATTGAGGGAAAAGGTGGAGGACAATTCCGCAGAACCTG
AATATATTATGACTAAAAGAGGCGTAGGATACTACTTCAGGAGGGCGTAA

Protein sequence :
MAKNILIVEDEKPISDIVRFNLEKEGYKVLVAYDGEDGVNKALTLNPDLVLLDVMLPKLDGFQVCRKIRASSSVPILMLT
AKEEEVDKVLGLEMGADDYITKPFGMRELLARVKANLRRTESGSGSNLEGIFTTGGIVIDFSKYEVRKNDTVIELTSREF
ELLKFLALQAEQVFTREQLLKQVWGYEYYGDIRTVDVTVRRLREKVEDNSAEPEYIMTKRGVGYYFRRA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-34 43
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 3e-40 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-33 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 3e-39 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Clos_2784 YP_001514311.1 two component transcriptional regulator NC_012469.1.7685629. Protein 8e-61 55
Clos_2784 YP_001514311.1 two component transcriptional regulator HE999704.1.gene2815. Protein 1e-50 50
Clos_2784 YP_001514311.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 1e-53 49
Clos_2784 YP_001514311.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 7e-54 49
Clos_2784 YP_001514311.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 7e-54 49
Clos_2784 YP_001514311.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 7e-54 49
Clos_2784 YP_001514311.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 7e-54 49
Clos_2784 YP_001514311.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 8e-54 49
Clos_2784 YP_001514311.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 7e-54 49
Clos_2784 YP_001514311.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 7e-54 49
Clos_2784 YP_001514311.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 7e-54 49
Clos_2784 YP_001514311.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 1e-53 49
Clos_2784 YP_001514311.1 two component transcriptional regulator AE000516.2.gene3505. Protein 9e-43 47
Clos_2784 YP_001514311.1 two component transcriptional regulator NC_003923.1003417.p0 Protein 6e-40 45
Clos_2784 YP_001514311.1 two component transcriptional regulator NC_013450.8614146.p0 Protein 6e-40 45
Clos_2784 YP_001514311.1 two component transcriptional regulator NC_002951.3238224.p0 Protein 6e-40 45
Clos_2784 YP_001514311.1 two component transcriptional regulator NC_007793.3914065.p0 Protein 6e-40 45
Clos_2784 YP_001514311.1 two component transcriptional regulator NC_002758.1121390.p0 Protein 6e-40 45
Clos_2784 YP_001514311.1 two component transcriptional regulator NC_010079.5776364.p0 Protein 6e-40 45
Clos_2784 YP_001514311.1 two component transcriptional regulator NC_002952.2859858.p0 Protein 6e-40 45
Clos_2784 YP_001514311.1 two component transcriptional regulator NC_007622.3794948.p0 Protein 6e-40 45
Clos_2784 YP_001514311.1 two component transcriptional regulator AE016830.1.gene1681. Protein 4e-45 45
Clos_2784 YP_001514311.1 two component transcriptional regulator AE015929.1.gene1106. Protein 1e-33 44
Clos_2784 YP_001514311.1 two component transcriptional regulator HE999704.1.gene1528. Protein 2e-37 44
Clos_2784 YP_001514311.1 two component transcriptional regulator NC_012469.1.7686381. Protein 2e-45 44
Clos_2784 YP_001514311.1 two component transcriptional regulator NC_014475.1.orf0.gen Protein 2e-40 43
Clos_2784 YP_001514311.1 two component transcriptional regulator NC_005054.2598277.p0 Protein 2e-40 43
Clos_2784 YP_001514311.1 two component transcriptional regulator CP000675.2.gene1535. Protein 7e-39 42
Clos_2784 YP_001514311.1 two component transcriptional regulator AF155139.2.orf0.gene Protein 1e-38 42
Clos_2784 YP_001514311.1 two component transcriptional regulator FJ349556.1.orf0.gene Protein 4e-39 42
Clos_2784 YP_001514311.1 two component transcriptional regulator BAC0308 Protein 1e-30 41
Clos_2784 YP_001514311.1 two component transcriptional regulator DQ212986.1.gene4.p01 Protein 5e-39 41
Clos_2784 YP_001514311.1 two component transcriptional regulator AM180355.1.gene1830. Protein 2e-38 41
Clos_2784 YP_001514311.1 two component transcriptional regulator BAC0596 Protein 2e-35 41
Clos_2784 YP_001514311.1 two component transcriptional regulator CP000647.1.gene2531. Protein 2e-36 41
Clos_2784 YP_001514311.1 two component transcriptional regulator CP001138.1.gene2239. Protein 2e-35 41
Clos_2784 YP_001514311.1 two component transcriptional regulator CP001918.1.gene3444. Protein 2e-35 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Clos_2784 YP_001514311.1 two component transcriptional regulator VFG0596 Protein 5e-35 43
Clos_2784 YP_001514311.1 two component transcriptional regulator VFG1389 Protein 9e-31 43
Clos_2784 YP_001514311.1 two component transcriptional regulator VFG1563 Protein 2e-40 42
Clos_2784 YP_001514311.1 two component transcriptional regulator VFG1702 Protein 1e-39 41