Gene Information

Name : Franean1_6572 (Franean1_6572)
Accession : YP_001510815.1
Strain : Frankia sp. EAN1.pec
Genome accession: NC_009921
Putative virulence/resistance : Resistance
Product : stress protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 7996375 - 7996959 bp
Length : 585 bp
Strand : -
Note : PFAM: stress protein; KEGG: fal:FRAAL0606 putative tellurium resistance protein

DNA sequence : 
ATGGCGATCAGCCTTGCCAAGGGCGGCAACGTCAGCCTCACGAAGCAGGCCGCCGAGGCAGGAACCGGAGCGCTGACCGC
GCTCACCGTCGGGCTCGGGTGGGATGCCCGCACGACGACCGGCACCGACTTCGATCTCGACGCCTCCGCCATCGGCGTGA
AGAGCGACGGCAAGGCACTGTCCGACGGGCACTTCGTCTTCTTCAACAACATGAAGTCCCCGGAGGGCGCCATCACGCTC
TCCGGCGACAACGTGACCGGCGCCGGCGAGGGCGACGACGAGTCCGTCAACATCAACCTGGGCCTGGTCCCGGCGGAGAT
CGACAAGATCGTCGTGCCGGTCTCCATCTACGACGCGGCGAACCGGGCCCAGAACTTCGGCCAGGTCCGCAACGCCTACA
TCCGCGTGGTGGACCAGACCGGCACCGAGCTCGTCCGTTACGACCTCTCCGAGGACTACTCGACCGAGACGGTCGTCATC
TTCGGCGAGGTGTACCGCAACGGAGCCGACTGGAAGTTCCGCGCGGTCGGCCAGGGGCACAACGACCTCAGCGGCCTCGC
CCGCGACCACGGCGTCAACGTCTGA

Protein sequence : 
MAISLAKGGNVSLTKQAAEAGTGALTALTVGLGWDARTTTGTDFDLDASAIGVKSDGKALSDGHFVFFNNMKSPEGAITL
SGDNVTGAGEGDDESVNINLGLVPAEIDKIVVPVSIYDAANRAQNFGQVRNAYIRVVDQTGTELVRYDLSEDYSTETVVI
FGEVYRNGADWKFRAVGQGHNDLSGLARDHGVNV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 8e-46 57
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 8e-46 57
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 6e-46 57
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-41 53
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 7e-41 53
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 2e-40 53
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 5e-43 52
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 4e-39 50

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Franean1_6572 YP_001510815.1 stress protein BAC0390 Protein 2e-44 54
Franean1_6572 YP_001510815.1 stress protein BAC0389 Protein 1e-40 52