Gene Information

Name : Franean1_1054 (Franean1_1054)
Accession : YP_001505416.1
Strain : Frankia sp. EAN1.pec
Genome accession: NC_009921
Putative virulence/resistance : Resistance
Product : stress protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 1238330 - 1238905 bp
Length : 576 bp
Strand : +
Note : PFAM: stress protein; KEGG: fal:FRAAL5898 tellurium resistance protein TerE

DNA sequence :
GTGGGAGTCAGCCTCAGCAAGGGCGGCAACGTGTCGCTGACCAAGGAGGCGCCCGGTCTCACGAACATCATCGTCGGTCT
CGGCTGGGACGTGCGGACGACCACCGGCGCCGACTTCGACCTGGACGCCAGCGCGATCGCGTGCCGGGCGGACGGCAAGG
TGGTCTCGGACGGGCACTTCATCTTCTTCAACAACCTGAAGAGCCCGGAAGGCGCGATCGAGCACCAGGGCGACAACCTC
ACCGGTGAGGGCGAGGGTGACGACGAGAAGATCAACGTCGACCTGGCGGGCCTCCCGACCGAGATCGACAAGATCGTCTT
TCCGGTCTCCATCTACGACGCGGACTCGCGCTCGCAGAGCTTCGGGCAGGTGCGAAACGCGTTCATCCGCGTGGTGAACG
CCGCCGGCCAGGCCGAGATCGCGCGCTACGACCTCACCGAGGACGCCTCGACCGAGACCGCCATGGTCTTCGGCGAGGTC
TACCGGCACGGGGCGGAGTGGAAGTTCCGCGCGGTCGGCCAGGGCTACGCCTCCGGCCTCGCGGGAATCGCCCGTGACTA
CGGGGTGAACGTCTGA

Protein sequence :
MGVSLSKGGNVSLTKEAPGLTNIIVGLGWDVRTTTGADFDLDASAIACRADGKVVSDGHFIFFNNLKSPEGAIEHQGDNL
TGEGEGDDEKINVDLAGLPTEIDKIVFPVSIYDADSRSQSFGQVRNAFIRVVNAAGQAEIARYDLTEDASTETAMVFGEV
YRHGAEWKFRAVGQGYASGLAGIARDYGVNV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-59 65
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-59 65
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 1e-59 65
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-59 65
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 3e-59 65
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-59 64
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 7e-59 64
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 3e-56 62
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 4e-29 42
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-26 41
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-26 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Franean1_1054 YP_001505416.1 stress protein BAC0389 Protein 8e-59 64
Franean1_1054 YP_001505416.1 stress protein BAC0390 Protein 3e-59 62
Franean1_1054 YP_001505416.1 stress protein BAC0392 Protein 5e-26 41