Gene Information

Name : Abu_0434 (Abu_0434)
Accession : YP_001489378.1
Strain : Arcobacter butzleri RM4018
Genome accession: NC_009850
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 435026 - 435703 bp
Length : 678 bp
Strand : -
Note : Pfam matches to PF00072 Response_reg, score 131.1, E-value 1.1E-039, and to PF00486 Trans_reg_C, score 66.7, E-value 6.7E-017

DNA sequence :
ATGATTTCTATGAAGATACTAATAATTGAAGATGATTTAAAAATCATAAACTTTTTAAAAAAAGGTTTAGAAGAAGAGTG
TTATATAGTTGACTTCTCAACAAATGGTGATGAAGGATTATACTTAGCTAGTATTAACACTTATGATCTAATCTTACTTG
ATATCATGCTTCCAGTTAAAAATGGAATTGAAGTATGTAAAAGTTTAAGAAGCTCAAATATTCAAACTCCTATTATTATG
CTAACAGCTAAAGATTCTATTGAAGATAAAATCAAAGGTTTAGATATTGGAGCAAATGATTATTTAGCAAAACCTTTTTC
TTTTGCAGAATTACTTGCCAGAATTAGAGTTCAATTAAGAATCACAACTACTACTCAAACAAAACTATCTATTGCAGATT
TAGAGCTTGATTTACTCAATAAAACAGCTTCAAGATCAAATCAAAATATAGTTTTAACAGCCAAAGAGTTTTCACTTTTA
GAGTATCTAATAAAAAATAAAAATAGAGTTTTAAGTGAAACAACAATAAATGAAGCACTTTCATCATTTGAAGATTCAAA
TATCAGTAATATTGTAAATGTTTATATTTATAGATTAAGAAATAAAATCGATAAAAATTTTGAAAATAAACTAATAAAAA
CAGTAAGAGGAATAGGATTTAAAATCAGTGAAGATTAA

Protein sequence :
MISMKILIIEDDLKIINFLKKGLEEECYIVDFSTNGDEGLYLASINTYDLILLDIMLPVKNGIEVCKSLRSSNIQTPIIM
LTAKDSIEDKIKGLDIGANDYLAKPFSFAELLARIRVQLRITTTTQTKLSIADLELDLLNKTASRSNQNIVLTAKEFSLL
EYLIKNKNRVLSETTINEALSSFEDSNISNIVNVYIYRLRNKIDKNFENKLIKTVRGIGFKISED

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 4e-44 46
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-43 45

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Abu_0434 YP_001489378.1 two-component response regulator BAC0125 Protein 3e-44 46
Abu_0434 YP_001489378.1 two-component response regulator BAC0347 Protein 4e-43 45
Abu_0434 YP_001489378.1 two-component response regulator BAC0111 Protein 9e-45 45
Abu_0434 YP_001489378.1 two-component response regulator BAC0308 Protein 5e-40 45
Abu_0434 YP_001489378.1 two-component response regulator BAC0197 Protein 2e-42 45
Abu_0434 YP_001489378.1 two-component response regulator BAC0638 Protein 1e-35 44
Abu_0434 YP_001489378.1 two-component response regulator AE016830.1.gene1681. Protein 1e-31 43
Abu_0434 YP_001489378.1 two-component response regulator BAC0083 Protein 7e-42 42
Abu_0434 YP_001489378.1 two-component response regulator HE999704.1.gene1528. Protein 2e-27 42
Abu_0434 YP_001489378.1 two-component response regulator NC_003923.1003417.p0 Protein 3e-29 41
Abu_0434 YP_001489378.1 two-component response regulator NC_013450.8614146.p0 Protein 3e-29 41
Abu_0434 YP_001489378.1 two-component response regulator NC_002951.3238224.p0 Protein 3e-29 41
Abu_0434 YP_001489378.1 two-component response regulator NC_007793.3914065.p0 Protein 3e-29 41
Abu_0434 YP_001489378.1 two-component response regulator NC_002758.1121390.p0 Protein 3e-29 41
Abu_0434 YP_001489378.1 two-component response regulator NC_010079.5776364.p0 Protein 3e-29 41
Abu_0434 YP_001489378.1 two-component response regulator NC_002952.2859858.p0 Protein 3e-29 41
Abu_0434 YP_001489378.1 two-component response regulator NC_007622.3794948.p0 Protein 3e-29 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Abu_0434 YP_001489378.1 two-component response regulator VFG0596 Protein 2e-44 46