Gene Information

Name : yceE (BPUM_0262)
Accession : YP_001485520.1
Strain : Bacillus pumilus SAFR-032
Genome accession: NC_009848
Putative virulence/resistance : Resistance
Product : TerD family tellurium resistance protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 256573 - 257151 bp
Length : 579 bp
Strand : +
Note : -

DNA sequence :
ATGGCGATTCAGCTATCAAAAGGACAACGTGTCGATTTAACAAAAACCAACCCAGGACTGACGAAAGTGATGATCGGTCT
TGGGTGGGATACGAATAAATATTCAGGTGGAGCCGAATTTGATTTGGACGCTTCAGCATTCTTAGTGGATGCAAACAATC
GTTGTCAGCAAGACACAGACTTTGTTTTCTATAATAACCTTCAGCATCCAAGCGGCAGTGTGACTCATACAGGTGATAAC
CGGACGGGTGAAGGAGATGGAGATGACGAGCAAATTCTCGTTGATTTCTCAAAAATTCCTGCTAACATTGATCGTATCGG
AATTACAGTAACGATTCATGATGCAGAGGCGCGCAGCCAGAATTTTGGACAAGTCTCAAATGCGTTTGTTCGTGTTGTAA
GTGAAGAGGGCGGGGAAGAATTGATTCGCTTTGATTTAGGGGAAGACTTCTCAATCGAAACAGCTGTTGTGGTATGTGAA
CTATACCGCCACGGAAGCGATTGGAAGTTTAACGCGATCGGAAGCGGATTCTCTGGCGGACTTGCAGCTCTTTGTCAAAA
TTATGGGTTAGAAGTATAA

Protein sequence :
MAIQLSKGQRVDLTKTNPGLTKVMIGLGWDTNKYSGGAEFDLDASAFLVDANNRCQQDTDFVFYNNLQHPSGSVTHTGDN
RTGEGDGDDEQILVDFSKIPANIDRIGITVTIHDAEARSQNFGQVSNAFVRVVSEEGGEELIRFDLGEDFSIETAVVVCE
LYRHGSDWKFNAIGSGFSGGLAALCQNYGLEV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 9e-57 58
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-48 54
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 1e-48 54
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-48 54
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-52 54
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 1e-52 54
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 3e-52 53
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 3e-47 52
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 1e-27 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
yceE YP_001485520.1 TerD family tellurium resistance protein BAC0390 Protein 3e-52 55
yceE YP_001485520.1 TerD family tellurium resistance protein BAC0389 Protein 8e-53 55