
| Name : fliQ (C8J_1576) Accession : YP_001483150.1 Strain : Campylobacter jejuni 81116 Genome accession: NC_009839 Putative virulence/resistance : Virulence Product : flagellar biosynthesis protein FliQ Function : - COG functional category : N : Cell motility COG ID : COG1987 EC number : - Position : 1583872 - 1584141 bp Length : 270 bp Strand : + Note : with proteins FliP and FliR forms the core of the central channel in the flagella export apparatus DNA sequence : ATGGACGAAAGTACCTTAGTTGCTCTTGGAGTGCAAACCTTTAAAATCACACTTTTACTTTCCTTGCCTATGCTTTTAGC AGGGCTTATTGCAGGGCTTGTAATCAGTATTTTTCAAGCAACTACACAGATTAACGAAATGACACTTTCTTTTGTTCCTA AAATCATCTTGGTTGTGGTTATTTTAATCTTTTTAATGCCTTGGATGACTACAACTATGATTGATTTTACTGAGAATATA CTAAATCAAATTCCAACTTTTATCAAATGA Protein sequence : MDESTLVALGVQTFKITLLLSLPMLLAGLIAGLVISIFQATTQINEMTLSFVPKIILVVVILIFLMPWMTTTMIDFTENI LNQIPTFIK | 
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity | 
| escS | AFO66401.1 | putative LEE-encoded type III secretion system factor | Virulence | SESS LEE | Protein | 3e-04 | 46 | 
| escS | AFO66341.1 | putative LEE-encoded type III secretion system factor | Virulence | SESS LEE | Protein | 3e-04 | 46 | 
| escS | ACU09472.1 | hypothetical protein | Not tested | LEE | Protein | 1e-05 | 45 | 
| escS | YP_003236102.1 | T3SS structure protein EscS | Virulence | LEE | Protein | 2e-05 | 45 | 
| escS | NP_290282.1 | hypothetical protein | Virulence | LEE | Protein | 2e-05 | 45 | 
| escS | AAC38370.1 | EscS | Virulence | LEE | Protein | 1e-05 | 45 | 
| ECs4582 | NP_312609.1 | EscS | Virulence | LEE | Protein | 2e-05 | 45 | 
| escS | AAC31527.1 | L0048 | Virulence | LEE | Protein | 1e-05 | 45 | 
| escS | CAI43888.1 | EscS protein | Virulence | LEE | Protein | 2e-04 | 43 | 
| unnamed | AAL06355.1 | EscS | Virulence | LEE | Protein | 1e-04 | 43 | 
| escS | YP_003223489.1 | T3SS structure protein EscS | Virulence | LEE | Protein | 2e-04 | 43 | 
| escS | AAK26701.1 | EscS | Virulence | LEE | Protein | 1e-04 | 43 | 
| escS | YP_003232139.1 | T3SS structure protein EscS | Virulence | LEE | Protein | 2e-04 | 43 | 
| escS | AAL57528.1 | EscS | Virulence | LEE | Protein | 1e-04 | 43 | 
| escS | CAC81848.1 | EscS protein | Virulence | LEE II | Protein | 1e-04 | 43 | 
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity | 
| fliQ | YP_001483150.1 | flagellar biosynthesis protein FliQ | VFG2339 | Protein | 1e-09 | 48 | 
| fliQ | YP_001483150.1 | flagellar biosynthesis protein FliQ | VFG0826 | Protein | 5e-06 | 45 | 
| fliQ | YP_001483150.1 | flagellar biosynthesis protein FliQ | VFG0716 | Protein | 5e-06 | 45 | 
 
 
  