Gene Information

Name : sulI (APECO1_O1R95)
Accession : YP_001481448.2
Strain :
Genome accession: NC_009838
Putative virulence/resistance : Resistance
Product : dihydropteroate synthase
Function : -
COG functional category : H : Coenzyme transport and metabolism
COG ID : COG0294
EC number : -
Position : 104477 - 105316 bp
Length : 840 bp
Strand : +
Note : sulfonamide resistance

DNA sequence :
ATGGTGACGGTGTTCGGCATTCTGAATCTCACCGAGGACTCCTTCTTCGATGAGAGCCGGCGGCTAGACCCCGCCGGCGC
TGTCACCGCGGCGATCGAAATGCTGCGAGTCGGATCAGACGTCGTGGATGTCGGACCGGCCGCCAGCCATCCGGACGCGA
GGCCTGTATCGCCGGCCGATGAGATCAGACGTATTGCGCCGCTCTTAGACGCCCTGTCCGATCAGATGCACCGTGTTTCA
ATCGACAGCTTCCAACCGGAAACCCAGCGCTATGCGCTCAAGCGCGGCGTGGGCTACCTGAACGATATCCAAGGATTTCC
TGACCCTGCGCTCTATCCCGATATTGCTGAGGCGGACTGCAGGCTGGTGGTTATGCACTCAGCGCAGCGGGATGGCATCG
CCACCCGCACCGGTCACCTTCGACCCGAAGACGCGCTCGACGAGATTGTGCGGTTCTTCGAGGCGCGGGTTTCCGCCTTG
CGACGGAGCGGGGTCGCTGCCGACCGGCTCATCCTCGATCCGGGGATGGGATTTTTCTTGAGCCCCGCACCGGAAACATC
GCTGCACGTGCTGTCGAACCTTCAAAAGCTGAAGTCGGCGTTGGGGCTTCCGCTATTGGTCTCGGTGTCGCGGAAATCCT
TCTTGGGCGCCACCGTTGGCCTTCCTGTAAAGGATCTGGGTCCAGCGAGCCTTGCGGCGGAACTTCACGCGATCGGCAAT
GGCGCTGACTACGTCCGCACCCACGCGCCTGGAGATCTGCGAAGCGCAATCACCTTCTCGGAAACCCTCGCGAAATTTCG
CAGTCGCGACGCCAGAGACCGAGGGTTAGATCATGCCTAG

Protein sequence :
MVTVFGILNLTEDSFFDESRRLDPAGAVTAAIEMLRVGSDVVDVGPAASHPDARPVSPADEIRRIAPLLDALSDQMHRVS
IDSFQPETQRYALKRGVGYLNDIQGFPDPALYPDIAEADCRLVVMHSAQRDGIATRTGHLRPEDALDEIVRFFEARVSAL
RRSGVAADRLILDPGMGFFLSPAPETSLHVLSNLQKLKSALGLPLLVSVSRKSFLGATVGLPVKDLGPASLAAELHAIGN
GADYVRTHAPGDLRSAITFSETLAKFRSRDARDRGLDHA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
sul1 AGK06980.1 Sul1 dihydropteroate synthase Not tested SGI1 Protein 5e-128 100
sul1 ADI24148.1 dihydropteroate synthase Not tested AbaR1 Protein 5e-128 100
sul1 YP_005797151.1 sulfonamide-resistant dihydropteroate synthase Not tested AbaR4e Protein 7e-128 100
sul1 AGK07017.1 Sul1 dihydropteroate synthase Not tested SGI1 Protein 5e-128 100
sul1 ADZ05756.1 dihydropteroate synthase Not tested AbaR10 Protein 5e-128 100
sulI YP_006098378.1 dihydropteroate synthase type-1 Not tested Tn2411 Protein 7e-128 100
sul1 AGK07075.1 Sul1 dihydropteroate synthase Not tested SGI1 Protein 5e-128 100
sul1 AET25390.1 Sul1 Not tested PAGI-2(C) Protein 5e-128 100
sul1 ACN81027.1 Sul1, sulfonamide-resistant dihydropteroate synthase Not tested AbaR5 Protein 7e-128 100
sul1 AGK07110.1 Sul1 dihydropteroate synthase Not tested SGI1 Protein 5e-128 100
sul1 AFG30113.1 Sul1 Not tested PAGI-2 Protein 5e-128 100
sul1 AFV53112.1 dihydropteroate synthase Not tested AbGRI2-1 Protein 5e-128 100
sul1 AGF34990.1 Sul1 dihydropteroate synthase Not tested SGI1 Protein 5e-128 100
sul1 AAG03004.2 sulfonamide resistance protein Not tested SGI1 Protein 5e-128 100
sul1 AGK36648.1 Sul1 Not tested AbaR26 Protein 5e-128 100
sul1 AGF35029.1 Sul1 dihydropteroate synthase Not tested SGI1 Protein 5e-128 100
sul1 ABB48429.1 sulfonamide insensitive dihydropteroate synthase Not tested SGI1 Protein 5e-128 100
sul1 AGF35064.1 Sul1 dihydropteroate synthase Not tested SGI1 Protein 5e-128 100
sul1 ACY75524.1 Sul1 Not tested Tn6060 Protein 5e-128 100
ACICU_00228 YP_001844887.1 dihydropteroate synthase Not tested AbaR20 Protein 7e-128 100
sul1 AGK06934.1 Sul1 dihydropteroate synthase Not tested SGI1 Protein 5e-128 100
sul1 ACY75531.1 Sul1 Not tested Tn6060 Protein 5e-128 100
sul1 YP_005797135.1 sulfonamide-resistant dihydropteroate synthase Not tested AbaR4e Protein 7e-128 100
sul1 YP_005160002.1 dihydropteroate synthase Not tested Not named Protein 3e-127 100
sul1 ACS32048.1 Sul1; sulfonamide-insensitive dihydropteroate synthase Not tested SGI2 Protein 2e-127 100
sul1 ACF06160.1 dihydropteroate synthase Not tested Tn5036-like Protein 1e-128 100
sulI CAJ77050.1 sul1delta fusion protein Not tested AbaR1 Protein 1e-127 100
sulI CAJ77089.1 sul1delta fusion protein Not tested AbaR1 Protein 1e-127 100
sul1 ADZ05750.1 dihydropteroate synthase Not tested AbaR10 Protein 5e-128 99
sul1 ADZ05806.1 dihydropteroate synthase Not tested AbaR20 Protein 4e-127 99
sul1 ACN81038.2 Sul1, sulfonamide-resistant dihydropteroate synthase Not tested AbaR5 Protein 7e-128 99
sul1 ACF06164.1 dihydropteroate synthase Not tested Tn5036-like Protein 2e-127 99
sulI CAJ77053.1 sul1delta fusion protein Not tested AbaR1 Protein 1e-127 99
sul2 YP_005176181.1 dihydropteroate synthase Not tested ICEPmu1 Protein 2e-47 55
sul2 AEA34678.1 dihydropteroate synthase Not tested Not named Protein 3e-54 53
sul2 AEZ06044.1 Sul2, sulphonamide-insensitive dihydropteroate synthase Not tested Tn6167 Protein 3e-54 53
sulI2 AFV47959.1 sulphonamide-insensitive dihydropteroate synthase SulI2 Not tested AbaR25 Protein 3e-54 53
BJAB0868_00253 YP_008211579.1 Dihydropteroate synthase-related enzyme Not tested AbaR26 Protein 9e-54 53
ABK1_0255 YP_005512827.1 Dihydropteroate synthase type-2 Not tested AbaR4d Protein 7e-54 53
BJAB07104_00246 YP_008207711.1 Dihydropteroate synthase-related enzyme Not tested AbaR25 Protein 7e-54 53

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
sulI YP_001481448.2 dihydropteroate synthase AY162283.2.gene6.p01 Protein 3e-128 100
sulI YP_001481448.2 dihydropteroate synthase EF118171.1.gene7.p01 Protein 3e-128 100
sulI YP_001481448.2 dihydropteroate synthase AB061794.1.gene5.p01 Protein 3e-128 100
sulI YP_001481448.2 dihydropteroate synthase AF313471.1.gene7.p01 Protein 3e-128 100
sulI YP_001481448.2 dihydropteroate synthase AY339625.2.gene19.p0 Protein 3e-128 100
sulI YP_001481448.2 dihydropteroate synthase AY740681.1.gene7.p01 Protein 3e-128 100
sulI YP_001481448.2 dihydropteroate synthase HQ451074.1.gene20.p0 Protein 3e-128 100
sulI YP_001481448.2 dihydropteroate synthase AF174129.3.gene6.p01 Protein 3e-128 100
sulI YP_001481448.2 dihydropteroate synthase U37105.2.gene6.p01 Protein 3e-128 100
sulI YP_001481448.2 dihydropteroate synthase AF191564.1.gene5.p01 Protein 7e-129 100
sulI YP_001481448.2 dihydropteroate synthase NC_011586.7045179.p0 Protein 3e-128 100
sulI YP_001481448.2 dihydropteroate synthase NC_011586.7045208.p0 Protein 1e-126 99
sulI YP_001481448.2 dihydropteroate synthase DQ143913.1.gene6.p01 Protein 2e-126 99
sulI YP_001481448.2 dihydropteroate synthase DQ464881.1.gene2.p01 Protein 5e-53 52
sulI YP_001481448.2 dihydropteroate synthase AJ459418.gene.p01 Protein 6e-55 44