Gene Information

Name : Spro_0478 (Spro_0478)
Accession : YP_001476714.1
Strain : Serratia proteamaculans 568
Genome accession: NC_009832
Putative virulence/resistance : Virulence
Product : DNA-binding transcriptional regulator BasR
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 528084 - 528746 bp
Length : 663 bp
Strand : -
Note : response regulator in two-component regulatory system with BasS

DNA sequence : 
ATGAAACTGCTGATTGTTGAAGACGATGAGCTGCTGCAGCAAGGCCTGGCCCTGGCATTAGCTGGCGAGGGCTATGCCTG
CGACTGCGCGGCTACGGCCGCGGAGGCCAATGCTCTGCTCCTCACCAGTCAGTACAGCATGATTATCCTCGATCTGGGCC
TGCCTGACATGGACGGCGCCAGCCTGCTTCGGCAGTGGCGCCGTCAGCAAGTCGAGCTGCCGGTGCTGATCCTGACCGCT
CGCGATGCGCTTGAAGACCGTGTTGATGGGCTGGACGCCGGCGCCGACGATTATCTGGTGAAACCCTTCGCGTTGGTTGA
ACTGCAGGCGCGCGTGCGGGCGCTGATCCGTCGCTATCAGGGTCACAGTGACAACCTCATGCAGCTCGATGACCTCCAAC
TCAATCTCTCCAGTCAGCAGGTTTATGTTCAGCAACAGCCGGTGGAAGTCACCCCGAAAGAGTTCGCCATCCTGTCACGT
CTGATGATGCGCGCCGGGCAAACGGTCAATCGTGAACTGCTGCAGCAGGATCTCTATACCTGGCAGGACGATTTGGGCTC
CAACACGCTGGAAGTACATATCCATAATCTGCGCCGCAAATTGGGTAAAGATCGCATCCGCACCGTTCGCGGTATCGGCT
ATCGTCTGGAATCCTCATCATGA

Protein sequence : 
MKLLIVEDDELLQQGLALALAGEGYACDCAATAAEANALLLTSQYSMIILDLGLPDMDGASLLRQWRRQQVELPVLILTA
RDALEDRVDGLDAGADDYLVKPFALVELQARVRALIRRYQGHSDNLMQLDDLQLNLSSQQVYVQQQPVEVTPKEFAILSR
LMMRAGQTVNRELLQQDLYTWQDDLGSNTLEVHIHNLRRKLGKDRIRTVRGIGYRLESSS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
armR AAN62112.1 putative response-regulator ArmR Not tested PAGI-2(C) Protein 4e-29 48
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 9e-20 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 5e-19 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Spro_0478 YP_001476714.1 DNA-binding transcriptional regulator BasR BAC0487 Protein 2e-45 65
Spro_0478 YP_001476714.1 DNA-binding transcriptional regulator BasR NC_002516.2.879194.p Protein 7e-22 44
Spro_0478 YP_001476714.1 DNA-binding transcriptional regulator BasR BAC0197 Protein 5e-20 43
Spro_0478 YP_001476714.1 DNA-binding transcriptional regulator BasR BAC0083 Protein 4e-21 43
Spro_0478 YP_001476714.1 DNA-binding transcriptional regulator BasR CP000647.1.gene1136. Protein 1e-21 43
Spro_0478 YP_001476714.1 DNA-binding transcriptional regulator BasR BAC0530 Protein 2e-21 43
Spro_0478 YP_001476714.1 DNA-binding transcriptional regulator BasR CP001918.1.gene2526. Protein 9e-22 41
Spro_0478 YP_001476714.1 DNA-binding transcriptional regulator BasR CP001138.1.gene1939. Protein 2e-21 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Spro_0478 YP_001476714.1 DNA-binding transcriptional regulator BasR VFG0473 Protein 6e-40 56
Spro_0478 YP_001476714.1 DNA-binding transcriptional regulator BasR VFG0596 Protein 3e-20 43
Spro_0478 YP_001476714.1 DNA-binding transcriptional regulator BasR VFG0475 Protein 2e-21 41