Gene Information

Name : Spro_1931 (Spro_1931)
Accession : YP_001478162.1
Strain : Serratia proteamaculans 568
Genome accession: NC_009832
Putative virulence/resistance : Resistance
Product : AraC family transcriptional regulator
Function : -
COG functional category : K : Transcription
COG ID : COG2207
EC number : -
Position : 2115133 - 2115489 bp
Length : 357 bp
Strand : +
Note : PFAM: helix-turn-helix- domain containing protein AraC type; KEGG: kpn:KPN_02968 putative helix-turn-helix, AraC type

DNA sequence :
ATGAACAGCACGGGTTTTATTACTGATTTGATTGAGTGGATTGATAACAATCTGGAAGAGAAGCTGGATATCAACACCGT
CGCGGGCCGGGCGGGGTATTCCAAGTGGCACCTGCAGCGAATGTTCAAACGCCAGACCGGTTACGCGCTGGGAGAGTATA
TTCGCATGCAGAAGCTGAGGGTCTCGGCGGAGCGCCTGGCCAACAGCGGCGAACCGATCGTCAGCGTGGCGATCTCACTC
GGCTTTGACTCGCAGCAGTCCTTCAATCGCAGTTTTAAACGCCACTATGGTCAAACCCCGGGCGACTGGCGCCGTGGCGT
GATGCAGCCATCCATGGCGGCTGGCCACACGCATTGA

Protein sequence :
MNSTGFITDLIEWIDNNLEEKLDINTVAGRAGYSKWHLQRMFKRQTGYALGEYIRMQKLRVSAERLANSGEPIVSVAISL
GFDSQQSFNRSFKRHYGQTPGDWRRGVMQPSMAAGHTH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
soxS YP_219131.1 DNA-binding transcriptional regulator SoxS Not tested SPI-4 Protein 3e-22 46
tetD AAL08447.1 putative transcriptional regulator TetD Not tested SRL Protein 1e-17 43
tetD AEA34665.1 tetracycline resistance protein D Not tested Not named Protein 1e-17 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Spro_1931 YP_001478162.1 AraC family transcriptional regulator CP000647.1.gene1624. Protein 9e-23 48
Spro_1931 YP_001478162.1 AraC family transcriptional regulator CP001918.1.gene2033. Protein 4e-23 48
Spro_1931 YP_001478162.1 AraC family transcriptional regulator BAC0560 Protein 1e-23 47
Spro_1931 YP_001478162.1 AraC family transcriptional regulator NC_002695.1.917339.p Protein 1e-23 47
Spro_1931 YP_001478162.1 AraC family transcriptional regulator CP000034.1.gene1596. Protein 9e-24 47
Spro_1931 YP_001478162.1 AraC family transcriptional regulator CP001138.1.gene4488. Protein 1e-22 46
Spro_1931 YP_001478162.1 AraC family transcriptional regulator CP001138.1.gene1637. Protein 2e-23 46
Spro_1931 YP_001478162.1 AraC family transcriptional regulator BAC0371 Protein 6e-23 45
Spro_1931 YP_001478162.1 AraC family transcriptional regulator NC_002695.1.914293.p Protein 6e-23 45
Spro_1931 YP_001478162.1 AraC family transcriptional regulator CP001918.1.gene327.p Protein 8e-23 44
Spro_1931 YP_001478162.1 AraC family transcriptional regulator CP000647.1.gene4499. Protein 4e-23 44
Spro_1931 YP_001478162.1 AraC family transcriptional regulator CP000034.1.gene4505. Protein 1e-22 44
Spro_1931 YP_001478162.1 AraC family transcriptional regulator CP001138.1.gene612.p Protein 2e-20 43
Spro_1931 YP_001478162.1 AraC family transcriptional regulator NC_010558.1.6276025. Protein 6e-18 43

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Spro_1931 YP_001478162.1 AraC family transcriptional regulator VFG0585 Protein 9e-23 46
Spro_1931 YP_001478162.1 AraC family transcriptional regulator VFG1038 Protein 5e-18 43