Gene Information

Name : Tlet_0986 (Tlet_0986)
Accession : YP_001470616.1
Strain : Thermotoga lettingae TMO
Genome accession: NC_009828
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1013862 - 1014653 bp
Length : 792 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: tma:TM1655 response regulator DrrA

DNA sequence :
ATGTTAACACGGAGTGAGTTTCGAAAAAACGTACTTTTCAGAAGGGGAGGTGTACCCGTAAAGGGTGAAAATATGGCGAA
AAAGAAAATACTTGTTGTCGATGACGATCCGTCTATCATCGAGTTAGTGAGTTACAATCTGGCACGCGAAGGTTATGATG
TTCTTAAAGCTTATGATGCAGAGGAAGCTTTAAAGGTTGTTGGGAACGAATCTGTTGACATGTTCATAGTGGATATCATG
TTACCCGGAATGGACGGTTTCGAACTCGTCAGGCAGCTCCGTTCCATGGAAAAATACAGGAACACACCTGTAGTTTTCTT
GAGCGCTAAAGGCGAAGAATTTGACAAAGTGCTTGGTCTGGAGCTTGGAGCAGATGATTATATTACGAAGCCATTCAGTA
TTAGAGAAATGATAGCTCGAATTAAGGCTGTTTTCAGGAGAATACAGCTGAGCGCACAGGAAAGAGAAGAAAGGCCTAAA
AAGATAGTAGCAAAAGGTTTAGAAATTGACGTTGAAAGATATGAAGTTAAAGTCCATGATCAAAAAGTTAGCCTGACACC
TCTTGAATTTGAGCTATTGAGATTTCTCGCAGAAAACGAGGGCAAAGTTTTCAGCAGAGATGTTCTTTTAGATAAGCTCT
GGGGTTATGATTATTACGGAGACACACGAACTGTGGATGTTCATATAAGAAGATTGAGAACAAAAATTGAAGAAGATCCA
TCAAATCCAAAGTATATAATTACAGTTAGAGGAAAAGGCTACAAATTCAGAGACCCAGGGAAGGAAGAATAA

Protein sequence :
MLTRSEFRKNVLFRRGGVPVKGENMAKKKILVVDDDPSIIELVSYNLAREGYDVLKAYDAEEALKVVGNESVDMFIVDIM
LPGMDGFELVRQLRSMEKYRNTPVVFLSAKGEEFDKVLGLELGADDYITKPFSIREMIARIKAVFRRIQLSAQEREERPK
KIVAKGLEIDVERYEVKVHDQKVSLTPLEFELLRFLAENEGKVFSRDVLLDKLWGYDYYGDTRTVDVHIRRLRTKIEEDP
SNPKYIITVRGKGYKFRDPGKEE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 4e-44 47
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-43 47

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Tlet_0986 YP_001470616.1 two component transcriptional regulator HE999704.1.gene2815. Protein 5e-50 50
Tlet_0986 YP_001470616.1 two component transcriptional regulator NC_012469.1.7685629. Protein 6e-53 49
Tlet_0986 YP_001470616.1 two component transcriptional regulator AE016830.1.gene1681. Protein 2e-52 48
Tlet_0986 YP_001470616.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 4e-51 48
Tlet_0986 YP_001470616.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 5e-51 48
Tlet_0986 YP_001470616.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 5e-51 48
Tlet_0986 YP_001470616.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 5e-51 48
Tlet_0986 YP_001470616.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 5e-51 48
Tlet_0986 YP_001470616.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 5e-51 48
Tlet_0986 YP_001470616.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 5e-51 48
Tlet_0986 YP_001470616.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 5e-51 48
Tlet_0986 YP_001470616.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 5e-51 48
Tlet_0986 YP_001470616.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 3e-51 48
Tlet_0986 YP_001470616.1 two component transcriptional regulator AF155139.2.orf0.gene Protein 7e-46 45
Tlet_0986 YP_001470616.1 two component transcriptional regulator NC_005054.2598277.p0 Protein 9e-45 45
Tlet_0986 YP_001470616.1 two component transcriptional regulator NC_014475.1.orf0.gen Protein 9e-45 45
Tlet_0986 YP_001470616.1 two component transcriptional regulator NC_012469.1.7686381. Protein 8e-46 44
Tlet_0986 YP_001470616.1 two component transcriptional regulator AE000516.2.gene3505. Protein 6e-41 44
Tlet_0986 YP_001470616.1 two component transcriptional regulator AM180355.1.gene1830. Protein 2e-40 43
Tlet_0986 YP_001470616.1 two component transcriptional regulator FJ349556.1.orf0.gene Protein 3e-44 42
Tlet_0986 YP_001470616.1 two component transcriptional regulator DQ212986.1.gene4.p01 Protein 9e-40 41
Tlet_0986 YP_001470616.1 two component transcriptional regulator AF162694.1.orf4.gene Protein 4e-38 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Tlet_0986 YP_001470616.1 two component transcriptional regulator VFG1563 Protein 2e-44 47
Tlet_0986 YP_001470616.1 two component transcriptional regulator VFG1702 Protein 9e-44 47
Tlet_0986 YP_001470616.1 two component transcriptional regulator VFG1389 Protein 6e-32 41