Gene Information

Name : CCC13826_2066 (CCC13826_2066)
Accession : YP_001467106.1
Strain : Campylobacter concisus 13826
Genome accession: NC_009802
Putative virulence/resistance : Resistance
Product : mercuric transporter periplasmic component
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG2608
EC number : -
Position : 1263565 - 1263822 bp
Length : 258 bp
Strand : -
Note : Periplasmic mercury ion-binding protein; Mercury scavenger protein; identified by match to protein family HMM PF00403

DNA sequence :
ATGCGTAAAATTTTAGTTTTAGCCCTTCTTGCACTTAGTTGCTACGCTGAGAAAACGATAGAAATTTCAGTGCCTAGCAT
GCACTGTCCGCTTTGCACAGCGATAGTTAGAAAGGCCGCACTTAGCGTTGAGGGCGTAAAAAAGGCAGATGTATCGCTAA
AAGAGCGAAAAGCTGTCGTTATAGCAGATGACAAGGTCGATGAAAAAGAGCTTTTAAAGGCGGTCGATGCGACTGGCTAT
AAAGGCGAGATAAAATAA

Protein sequence :
MRKILVLALLALSCYAEKTIEISVPSMHCPLCTAIVRKAALSVEGVKKADVSLKERKAVVIADDKVDEKELLKAVDATGY
KGEIK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ABR13399.1 copper-transporting ATPase 2 Not tested PAGI-5 Protein 2e-08 43
merP CAJ77062.1 Periplasmic mercuric ion binding protein Not tested AbaR1 Protein 7e-08 43
merP ACN81007.1 MerP periplasmic mercuric ion binding protein Not tested AbaR5 Protein 1e-07 43
merP AGK07081.1 MerP Not tested SGI1 Protein 2e-07 41
merP YP_006098389.1 mercuric ion transport protein Not tested Tn2411 Protein 2e-07 41
merP ABQ57373.1 MerP Not tested SGI1 Protein 2e-07 41
merP AET25399.1 MerP Not tested PAGI-2(C) Protein 2e-07 41
merP AFG30122.1 MerP Not tested PAGI-2 Protein 2e-07 41
merP AGK07023.1 MerP Not tested SGI1 Protein 2e-07 41
merP AAN62179.1 periplasmic mercuric ion binding protein MerP Not tested PAGI-2(C) Protein 5e-08 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CCC13826_2066 YP_001467106.1 mercuric transporter periplasmic component BAC0679 Protein 3e-08 43
CCC13826_2066 YP_001467106.1 mercuric transporter periplasmic component BAC0678 Protein 2e-08 43
CCC13826_2066 YP_001467106.1 mercuric transporter periplasmic component BAC0231 Protein 2e-08 41