Gene Information

Name : EcE24377A_4902 (EcE24377A_4902)
Accession : YP_001465830.1
Strain : Escherichia coli E24377A
Genome accession: NC_009801
Putative virulence/resistance : Virulence
Product : hypothetical protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4886593 - 4886769 bp
Length : 177 bp
Strand : +
Note : identified by similarity to GB:ABB61172.1; match to protein family HMM PF06117

DNA sequence :
ATGAAATCATTAACCACGGAAACAGCGCTGGATATTCTGATTACGTGGCTGCAGGACAATATCGACTGCGAATCGGGAAT
TATCTTCGACAACGATGAGGATAAAACAGGTTCGGCAGCACTGTTGCGCTGTATCGAACAGGCCAGGGAGGGTATCCGTA
CCCTGCGCCAACAGTAA

Protein sequence :
MKSLTTETALDILITWLQDNIDCESGIIFDNDEDKTGSAALLRCIEQAREGIRTLRQQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
ECO103_3594 YP_003223451.1 hypothetical protein Not tested LEE Protein 3e-18 93
SF3001 NP_708775.1 hypothetical protein Not tested SHI-1 Protein 1e-17 92
unnamed AAK00484.1 unknown Not tested SHI-1 Protein 1e-17 92
z1225 CAD33791.1 Z1225 protein Not tested PAI I 536 Protein 3e-18 92
unnamed ADD91697.1 hypothetical conserved protein Not tested PAI-I AL862 Protein 1e-18 92
unnamed CAI43850.1 hypothetical protein Not tested LEE Protein 1e-18 92
unnamed CAD66209.1 hypothetical protein Not tested PAI III 536 Protein 5e-18 92
ECO111_3780 YP_003236115.1 hypothetical protein Not tested LEE Protein 4e-18 90
c5147 NP_756995.1 hypothetical protein Not tested PAI II CFT073 Protein 1e-17 88
unnamed AAL67387.1 L0009-like protein Not tested PAI II CFT073 Protein 8e-18 88
Z1225 NP_286759.1 hypothetical protein Not tested TAI Protein 9e-18 88
unnamed AAL08480.1 unknown Not tested SRL Protein 6e-18 88
unnamed CAE85206.1 hypothetical protein Not tested PAI V 536 Protein 4e-18 88
Z1663 NP_287165.1 hypothetical protein Not tested TAI Protein 6e-18 88
unnamed CAD42103.1 hypothetical protein Not tested PAI II 536 Protein 1e-17 86
unnamed AAC31488.1 L0009 Not tested LEE Protein 4e-15 82
Z5093 NP_290244.1 hypothetical protein Not tested LEE Protein 6e-15 82
unnamed ACU09435.1 conserved hypothetical protein Not tested LEE Protein 4e-15 82
ECs4541 NP_312568.1 hypothetical protein Not tested LEE Protein 6e-15 82

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
EcE24377A_4902 YP_001465830.1 hypothetical protein VFG0665 Protein 4e-18 92
EcE24377A_4902 YP_001465830.1 hypothetical protein VFG1532 Protein 1e-18 92
EcE24377A_4902 YP_001465830.1 hypothetical protein VFG1684 Protein 2e-18 92
EcE24377A_4902 YP_001465830.1 hypothetical protein VFG1071 Protein 3e-18 88
EcE24377A_4902 YP_001465830.1 hypothetical protein VFG1622 Protein 6e-18 86
EcE24377A_4902 YP_001465830.1 hypothetical protein VFG0788 Protein 2e-15 82