Gene Information

Name : EcE24377A_4900 (EcE24377A_4900)
Accession : YP_001465828.1
Strain : Escherichia coli E24377A
Genome accession: NC_009801
Putative virulence/resistance : Virulence
Product : hypothetical protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 4885714 - 4886088 bp
Length : 375 bp
Strand : +
Note : identified by match to protein family HMM PF06755

DNA sequence :
ATGAAAACATTACCCGACACGCATGTACGGGAGGTATCGTGCTGCCCGTCTCCCGTCACCATCTGGCAGACACTGCTCAC
CCGGTTACTGGACCAGCATTACAGCCTTACGCTGAATGACACACCGTTCGTGGATGAACGCGTGATTGAGCAGCATATTG
AGGCAGGCATTTCACTGTGTGATGCAGTGAACTTTCTCGTGGAAAAATACGCACTGGTACGAACTGACCAGCCGGGATTC
AGCGCAGGAGCCTCGTCGCAGTTAATCAACAGCATTGATATTCTCCGGGCTCGCCGGGCAACAGGCCTGATGACCCGCCA
CAACTACAGAACGGTGAACAATATCACCCTGGGTAAGTATCCGGAGGCGAAATGA

Protein sequence :
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRHNYRTVNNITLGKYPEAK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed AAL08478.1 unknown Not tested SRL Protein 8e-50 93
z5091 CAD33789.1 Z5091 protein Not tested PAI I 536 Protein 6e-49 92
unnamed AAK00482.1 unknown Not tested SHI-1 Protein 6e-50 92
yeeV NP_708773.1 hypothetical protein Not tested SHI-1 Protein 9e-50 92
yeeV YP_854325.1 hypothetical protein Not tested PAI I APEC-O1 Protein 8e-50 92
ECO103_3592 YP_003223449.1 hypothetical protein Not tested LEE Protein 1e-49 92
yeeV NP_838487.1 hypothetical protein Not tested SHI-1 Protein 9e-50 92
yeeV AAZ04461.1 conserved hypothetical protein Not tested PAI I APEC-O1 Protein 1e-48 92
unnamed ACU09433.1 conserved hypothetical protein Not tested LEE Protein 1e-48 91
Z5091 NP_290242.1 hypothetical protein Not tested LEE Protein 2e-48 91
ECs4539 NP_312566.1 hypothetical protein Not tested LEE Protein 2e-48 91
unnamed AAC31486.1 L0007 Not tested LEE Protein 1e-48 91
unnamed AAL57575.1 unknown Not tested LEE Protein 1e-47 91
yeeV ADD91699.1 YeeV Not tested PAI-I AL862 Protein 4e-49 91
unnamed CAD66207.1 hypothetical protein Not tested PAI III 536 Protein 9e-47 90
unnamed AAL67389.1 L0007-like protein Not tested PAI II CFT073 Protein 8e-49 90
yeeV CAE85204.1 YeeV protein Not tested PAI V 536 Protein 2e-47 90
c5149 NP_756997.1 hypothetical protein Not tested PAI II CFT073 Protein 1e-48 90
unnamed CAI43848.1 hypothetical protein Not tested LEE Protein 1e-48 89
aec76 AAW51759.1 Aec76 Not tested AGI-3 Protein 1e-48 89
unnamed CAD42101.1 hypothetical protein Not tested PAI II 536 Protein 7e-48 89
unnamed AAL67342.1 intergenic-region protein Not tested PAI II CFT073 Protein 7e-46 88

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
EcE24377A_4900 YP_001465828.1 hypothetical protein VFG1069 Protein 3e-50 93
EcE24377A_4900 YP_001465828.1 hypothetical protein VFG1530 Protein 3e-49 92
EcE24377A_4900 YP_001465828.1 hypothetical protein VFG0663 Protein 2e-50 92
EcE24377A_4900 YP_001465828.1 hypothetical protein VFG0786 Protein 6e-49 91
EcE24377A_4900 YP_001465828.1 hypothetical protein VFG1682 Protein 4e-47 90
EcE24377A_4900 YP_001465828.1 hypothetical protein VFG1620 Protein 3e-48 89