Gene Information

Name : CKO_02591 (CKO_02591)
Accession : YP_001454136.1
Strain : Citrobacter koseri ATCC BAA-895
Genome accession: NC_009792
Putative virulence/resistance : Resistance
Product : hypothetical protein
Function : -
COG functional category : K : Transcription
COG ID : COG4977
EC number : -
Position : 2397642 - 2398022 bp
Length : 381 bp
Strand : -
Note : KEGG: bcz:BCZK3497 5.1e-09 adaA; transcriptional regulator, AraC family K00567; COG: COG2207 AraC-type DNA-binding domain-containing proteins; Psort location: nuclear, score: 23

DNA sequence :
GTGGGAATAAGCGACCATTTTTCGGAGGGGGAGAGCACGATGACCATTTCCGCTCAGGTAATCGACACTATTGTCGAGTG
GATTGATGATAATTTAAATCAACCGTTGCGCATTGATGATATTGCCCGCCACGCCGGGTACTCCAAATGGCATCTGCAAC
GCCTGTTTATGCAGTACAAAGGGGAGAGTCTGGGGCGCTATATCCGGGAGCGTAAGCTGCGGCTGGCGGCGCGTGATTTA
CGCGATACCGACCAAAGGGTGTATGACATCTGCCTGAAGTACGGTTTTGATTCGCAGCAGACCTTTACGCGGATCTTCAC
CCGAACCTTTAATCAGCCGCCGGGCGCCTACCGTAAAGAGAATCACAGCCGTACGCACTGA

Protein sequence :
MGISDHFSEGESTMTISAQVIDTIVEWIDDNLNQPLRIDDIARHAGYSKWHLQRLFMQYKGESLGRYIRERKLRLAARDL
RDTDQRVYDICLKYGFDSQQTFTRIFTRTFNQPPGAYRKENHSRTH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
soxS YP_219131.1 DNA-binding transcriptional regulator SoxS Not tested SPI-4 Protein 5e-13 50
tetD AAL08447.1 putative transcriptional regulator TetD Not tested SRL Protein 3e-12 48
tetD AEA34665.1 tetracycline resistance protein D Not tested Not named Protein 3e-12 48

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CKO_02591 YP_001454136.1 hypothetical protein CP001138.1.gene612.p Protein 5e-33 95
CKO_02591 YP_001454136.1 hypothetical protein CP001918.1.gene327.p Protein 8e-14 50
CKO_02591 YP_001454136.1 hypothetical protein CP000647.1.gene4499. Protein 9e-14 50
CKO_02591 YP_001454136.1 hypothetical protein CP001138.1.gene4488. Protein 1e-13 50
CKO_02591 YP_001454136.1 hypothetical protein NC_010558.1.6276025. Protein 1e-12 48
CKO_02591 YP_001454136.1 hypothetical protein NC_002695.1.914293.p Protein 1e-12 47
CKO_02591 YP_001454136.1 hypothetical protein BAC0371 Protein 1e-12 47
CKO_02591 YP_001454136.1 hypothetical protein CP000647.1.gene1624. Protein 4e-13 47
CKO_02591 YP_001454136.1 hypothetical protein CP000034.1.gene4505. Protein 3e-12 46
CKO_02591 YP_001454136.1 hypothetical protein CP001918.1.gene2033. Protein 3e-13 46
CKO_02591 YP_001454136.1 hypothetical protein CP001138.1.gene1637. Protein 2e-13 45
CKO_02591 YP_001454136.1 hypothetical protein CP000034.1.gene1596. Protein 7e-14 44
CKO_02591 YP_001454136.1 hypothetical protein NC_002695.1.917339.p Protein 1e-13 44
CKO_02591 YP_001454136.1 hypothetical protein BAC0560 Protein 1e-13 44

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CKO_02591 YP_001454136.1 hypothetical protein VFG0585 Protein 1e-13 50
CKO_02591 YP_001454136.1 hypothetical protein VFG1038 Protein 1e-12 48