Gene Information

Name : SGO_0779 (SGO_0779)
Accession : YP_001450078.1
Strain : Streptococcus gordonii Challis
Genome accession: NC_009785
Putative virulence/resistance : Virulence
Product : response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 818820 - 819521 bp
Length : 702 bp
Strand : +
Note : identified by match to protein family HMM PF00072; match to protein family HMM PF00486

DNA sequence :
ATGAAGAAAATATTAGTTGTAGATGATGAAAAACCAATTTCAGATATTATAAAATTTAATATGGTAAAAGAGGGCTATGA
AGTTGTTACGGCTTTTGATGGTCGTGAAGCTCTTGAGATGTTTGAAGCTGAAAATCCTGATATTTTGATTTTGGATTTGA
TGTTGCCAGAGTTGGACGGGCTAGAAGTAGCACGCACCATTCGGAAGACCAGTAATGTTCCAATTATTGTCCTATCGGCT
AAAGATAGTGAGTTTGATAAAGTTATCGGCCTTGAGATCGGAGCAGACGACTATGTGACTAAGCCTTTCTCTAACCGTGA
GCTCCAAGCTCGTGTCAAGGCTATTTTGCGACGTTCAGAATTTGCTGTAGATACCCAAGAAAATGAAAAGGGCTCAAATG
AGTTGACAGTGGGTGAATTGCAAATTTTACCCGATGCTTTTGTTGCCAAAAAACATGGTGAAGAGCTAGAATTAACCCAT
CGTGAGTTTGAATTACTCTACCATTTGGCTAGTCATGTTGGTCAAGTAATGACACGCGAACACCTGTTAGAGACAGTTTG
GGGTTATGATTATTTTGGTGATGTACGCACTGTTGATGTGACGATTCGCCGTCTACGTGAAAAGATTGAAGATACGCCAA
GCCGACCAGAGTATATTTTAACTCGTCGTGGTGTTGGCTACTATATGAGAAACAATGATTGA

Protein sequence :
MKKILVVDDEKPISDIIKFNMVKEGYEVVTAFDGREALEMFEAENPDILILDLMLPELDGLEVARTIRKTSNVPIIVLSA
KDSEFDKVIGLEIGADDYVTKPFSNRELQARVKAILRRSEFAVDTQENEKGSNELTVGELQILPDAFVAKKHGEELELTH
REFELLYHLASHVGQVMTREHLLETVWGYDYFGDVRTVDVTIRRLREKIEDTPSRPEYILTRRGVGYYMRNND

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 5e-37 43
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 8e-37 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SGO_0779 YP_001450078.1 response regulator NC_012469.1.7685629. Protein 2e-94 84
SGO_0779 YP_001450078.1 response regulator NC_002952.2859905.p0 Protein 7e-58 56
SGO_0779 YP_001450078.1 response regulator NC_009641.5332272.p0 Protein 5e-58 56
SGO_0779 YP_001450078.1 response regulator NC_013450.8614421.p0 Protein 5e-58 56
SGO_0779 YP_001450078.1 response regulator NC_007793.3914279.p0 Protein 5e-58 56
SGO_0779 YP_001450078.1 response regulator NC_007622.3794472.p0 Protein 6e-58 56
SGO_0779 YP_001450078.1 response regulator NC_002745.1124361.p0 Protein 5e-58 56
SGO_0779 YP_001450078.1 response regulator NC_009782.5559369.p0 Protein 5e-58 56
SGO_0779 YP_001450078.1 response regulator NC_002951.3237708.p0 Protein 5e-58 56
SGO_0779 YP_001450078.1 response regulator NC_003923.1003749.p0 Protein 4e-58 56
SGO_0779 YP_001450078.1 response regulator NC_002758.1121668.p0 Protein 5e-58 56
SGO_0779 YP_001450078.1 response regulator HE999704.1.gene2815. Protein 3e-54 54
SGO_0779 YP_001450078.1 response regulator NC_012469.1.7686381. Protein 4e-46 47
SGO_0779 YP_001450078.1 response regulator AE016830.1.gene1681. Protein 4e-48 47
SGO_0779 YP_001450078.1 response regulator AF155139.2.orf0.gene Protein 1e-42 46
SGO_0779 YP_001450078.1 response regulator FJ349556.1.orf0.gene Protein 3e-42 46
SGO_0779 YP_001450078.1 response regulator NC_002695.1.915041.p Protein 9e-36 44
SGO_0779 YP_001450078.1 response regulator CP000034.1.gene3834. Protein 9e-36 44
SGO_0779 YP_001450078.1 response regulator CP001918.1.gene5135. Protein 1e-30 44
SGO_0779 YP_001450078.1 response regulator BAC0533 Protein 6e-35 43
SGO_0779 YP_001450078.1 response regulator CP004022.1.gene3215. Protein 1e-38 43
SGO_0779 YP_001450078.1 response regulator CP001138.1.gene4273. Protein 2e-35 43
SGO_0779 YP_001450078.1 response regulator CP000647.1.gene4257. Protein 6e-35 43
SGO_0779 YP_001450078.1 response regulator AM180355.1.gene1830. Protein 9e-39 43
SGO_0779 YP_001450078.1 response regulator NC_003923.1003417.p0 Protein 1e-39 42
SGO_0779 YP_001450078.1 response regulator NC_013450.8614146.p0 Protein 1e-39 42
SGO_0779 YP_001450078.1 response regulator NC_002951.3238224.p0 Protein 1e-39 42
SGO_0779 YP_001450078.1 response regulator NC_007793.3914065.p0 Protein 1e-39 42
SGO_0779 YP_001450078.1 response regulator NC_002758.1121390.p0 Protein 1e-39 42
SGO_0779 YP_001450078.1 response regulator NC_010079.5776364.p0 Protein 1e-39 42
SGO_0779 YP_001450078.1 response regulator NC_002952.2859858.p0 Protein 1e-39 42
SGO_0779 YP_001450078.1 response regulator NC_007622.3794948.p0 Protein 1e-39 42
SGO_0779 YP_001450078.1 response regulator HE999704.1.gene1528. Protein 7e-37 42
SGO_0779 YP_001450078.1 response regulator AF162694.1.orf4.gene Protein 2e-33 42
SGO_0779 YP_001450078.1 response regulator NC_005054.2598277.p0 Protein 2e-37 42
SGO_0779 YP_001450078.1 response regulator NC_014475.1.orf0.gen Protein 2e-37 42
SGO_0779 YP_001450078.1 response regulator AE015929.1.gene1106. Protein 4e-35 41
SGO_0779 YP_001450078.1 response regulator DQ212986.1.gene4.p01 Protein 1e-36 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SGO_0779 YP_001450078.1 response regulator VFG1389 Protein 7e-34 45
SGO_0779 YP_001450078.1 response regulator VFG1563 Protein 3e-37 43
SGO_0779 YP_001450078.1 response regulator VFG1702 Protein 3e-37 42