Gene Information

Name : VIBHAR_01676 (VIBHAR_01676)
Accession : YP_001444872.1
Strain :
Genome accession: NC_009783
Putative virulence/resistance : Unknown
Product : hypothetical protein
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG2963
EC number : -
Position : 1686676 - 1686987 bp
Length : 312 bp
Strand : +
Note : COG: COG2963 Transposase and inactivated derivatives; Psort location: mitochondrial, score: 23

DNA sequence :
ATGACAAAGCGTACGAGAAGAACTTTCAGCCCAGAATTCAAACTTGAGGCAGCCCAGCTAGTTGTTGACCAAGGTTACTC
GGTGGTCGAAGCAGCTAAAGCTATGAATGTGAGCAAATCTGCTATGGACAAGTGGGTAAGGCAGCTTAAACAAGAGAGAC
AGGGCATCACCCCGAAAGCATCGCCGCTGACGCCAGAACAAATTGAGAGCCGCGAGCTTAAAAAGCGGATTGCCGAGCTG
GAAGATCACAACGAAATCATAAAAAAGGCTACAGCTCTGTTGATGTCGGACTCACTGAAAAATTCTCGATAA

Protein sequence :
MTKRTRRTFSPEFKLEAAQLVVDQGYSVVEAAKAMNVSKSAMDKWVRQLKQERQGITPKASPLTPEQIESRELKKRIAEL
EDHNEIIKKATALLMSDSLKNSR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
orfA ACX47959.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-35 82
VPI2_0009c ACA01826.1 transposase OrfAB subunit A Not tested VPI-2 Protein 2e-35 82
orfA AGK06911.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-35 82
unnamed AGK06948.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-35 82
VC1790 NP_231425.1 transposase OrfAB subunit A Not tested VPI-2 Protein 3e-35 82
orfA AGK06994.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-35 82
orfA YP_001217330.1 transposase OrfAB subunit A Not tested VPI-2 Protein 3e-35 82
orfA AGK07052.1 IS1359 transposase; OrfA Not tested SGI1 Protein 2e-35 82
l7045 CAD33744.1 - Not tested PAI I 536 Protein 5e-28 67
orfA CAE85179.1 OrfA protein, IS911 Not tested PAI V 536 Protein 5e-28 67
insN YP_002152325.1 transposase for insertion sequence element IS911 Not tested Not named Protein 6e-27 67
unnamed CAD42034.1 hypothetical protein Not tested PAI II 536 Protein 8e-25 65
api80 CAF28554.1 putative transposase Not tested YAPI Protein 1e-22 64
ECO111_3778 YP_003236113.1 putative IS602 transposase OrfA Not tested LEE Protein 1e-28 62
aec66 AAW51749.1 Aec66 Not tested AGI-3 Protein 7e-29 62
unnamed ACU09431.1 IS911 transposase orfA Not tested LEE Protein 5e-28 61
Z5088 NP_290240.1 hypothetical protein Not tested LEE Protein 7e-28 61
ECs4535 NP_312562.1 hypothetical protein Not tested LEE Protein 7e-28 61
unnamed AAC31483.1 L0004 Not tested LEE Protein 4e-28 61
RS05 AAP82950.1 putative transposase Not tested PAPI-2 Protein 2e-23 57
unnamed CAD42047.1 hypothetical protein Not tested PAI II 536 Protein 1e-13 48
unnamed CAD33780.1 putative transposase Not tested PAI I 536 Protein 2e-12 46
trp1329A CAB46577.1 IS1329 transposase A Not tested HPI Protein 8e-16 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
VIBHAR_01676 YP_001444872.1 hypothetical protein VFG1123 Protein 9e-36 82
VIBHAR_01676 YP_001444872.1 hypothetical protein VFG1485 Protein 2e-28 67
VIBHAR_01676 YP_001444872.1 hypothetical protein VFG1553 Protein 3e-25 65
VIBHAR_01676 YP_001444872.1 hypothetical protein VFG0784 Protein 2e-28 61
VIBHAR_01676 YP_001444872.1 hypothetical protein VFG1566 Protein 6e-14 48
VIBHAR_01676 YP_001444872.1 hypothetical protein VFG1521 Protein 6e-13 46