Gene Information

Name : ESA_00920 (ESA_00920)
Accession : YP_001437026.1
Strain : Cronobacter sakazakii ATCC BAA-894
Genome accession: NC_009778
Putative virulence/resistance : Resistance
Product : hypothetical protein
Function : -
COG functional category : K : Transcription
COG ID : COG2207
EC number : -
Position : 886255 - 886599 bp
Length : 345 bp
Strand : +
Note : KEGG: bcz:BCZK3497 4.0e-09 adaA; transcriptional regulator, AraC family K00567; COG: COG2207 AraC-type DNA-binding domain-containing proteins; Psort location: nuclear, score: 23

DNA sequence : 
ATGGAACTTCCCGCTCAGGTTATTGAAACGCTGACCGACTGGATTGATGACAATCTTCATAAGCCGCTGCGCATTGATGA
TATCGCGCGCCACGCGGGTTATTCGAAATGGCATTTGCAGCGGCTTTTTCACCATCATAAAGGGGAGAGCATCGGGCGTT
ATATTCGCGAGAAAAAGCTGCGGCTGGCGGCGCAGGACCTGCGTGCCACCAACGACCGCGTGCTGGATATTTCCATGAAA
TACGGGTTCGATTCTCAGCAAACTTTTACGAGACTCTTCACGCGTAAGTATCGGATGTCGCCTGGCACCTGGCGCAAGCA
GGGCGATGCCCCGACCAACCACTGA

Protein sequence : 
MELPAQVIETLTDWIDDNLHKPLRIDDIARHAGYSKWHLQRLFHHHKGESIGRYIREKKLRLAAQDLRATNDRVLDISMK
YGFDSQQTFTRLFTRKYRMSPGTWRKQGDAPTNH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
soxS YP_219131.1 DNA-binding transcriptional regulator SoxS Not tested SPI-4 Protein 2e-22 46
tetD AAL08447.1 putative transcriptional regulator TetD Not tested SRL Protein 6e-20 42
tetD AEA34665.1 tetracycline resistance protein D Not tested Not named Protein 6e-20 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ESA_00920 YP_001437026.1 hypothetical protein CP001138.1.gene612.p Protein 4e-37 67
ESA_00920 YP_001437026.1 hypothetical protein CP001918.1.gene327.p Protein 1e-23 48
ESA_00920 YP_001437026.1 hypothetical protein CP000647.1.gene4499. Protein 2e-23 46
ESA_00920 YP_001437026.1 hypothetical protein CP001138.1.gene4488. Protein 6e-23 46
ESA_00920 YP_001437026.1 hypothetical protein CP001918.1.gene2033. Protein 4e-21 45
ESA_00920 YP_001437026.1 hypothetical protein NC_002695.1.914293.p Protein 6e-22 44
ESA_00920 YP_001437026.1 hypothetical protein BAC0371 Protein 6e-22 44
ESA_00920 YP_001437026.1 hypothetical protein CP000647.1.gene1624. Protein 1e-20 44
ESA_00920 YP_001437026.1 hypothetical protein NC_002695.1.917339.p Protein 7e-21 44
ESA_00920 YP_001437026.1 hypothetical protein CP001138.1.gene1637. Protein 8e-21 44
ESA_00920 YP_001437026.1 hypothetical protein BAC0560 Protein 7e-21 44
ESA_00920 YP_001437026.1 hypothetical protein CP000034.1.gene1596. Protein 6e-21 44
ESA_00920 YP_001437026.1 hypothetical protein CP000034.1.gene4505. Protein 1e-21 43
ESA_00920 YP_001437026.1 hypothetical protein NC_010558.1.6276025. Protein 3e-20 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ESA_00920 YP_001437026.1 hypothetical protein VFG0585 Protein 5e-23 46
ESA_00920 YP_001437026.1 hypothetical protein VFG1038 Protein 2e-20 42