Gene Information

Name : ESA_04133 (ESA_04133)
Accession : YP_001440151.1
Strain : Cronobacter sakazakii ATCC BAA-894
Genome accession: NC_009778
Putative virulence/resistance : Virulence
Product : transcriptional regulatory protein YedW
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 4086927 - 4087607 bp
Length : 681 bp
Strand : +
Note : induced by CusR in the presence of copper; YedW induces the expression of the upstream gene yedV (encoding a sensor kinase) as well as yedW; yedVW is one of four copper regulons found in E. coli; part of the copper homeostasis mechanism; confers resistanc

DNA sequence :
ATGAAACTGCTGCTGATTGAAGACAACGACAAAACCCGCGCGTGGCTCGAAAAAGGGCTGCGGGAGGCGGGGCTGGTAGT
GGACACTGTCGCCGACGGGCGCGATGGCCTGCACCTGGCTCTGGAGCAAGACTACGCGCTGATTATCCTCGATATCATGC
TGCCGGGGCTCGACGGCTGGCAGGTGTTGCGCGCGCTGCGCACCGCCAAAGCCACGCCGGTGCTCTGCCTGACGGCCAGA
GATGCGGTAAGCGATCGCGTGAAAGGGCTGGAGCTGGGGGCCGATGATTATCTGGTGAAGCCCTTTTCCTTCGCCGAACT
GCTGGCGCGCGTGCGGGCGCAACTGCGCCGCCATGCGCCTGCCGCCGCGACGCTACAGGTGGCGGATCTGACGCTTGATA
CCGCGCGCCACGCCGCCAGCCGCGGCGGCGAGCGGATCGCGCTGACCCGCCAGGAATTTACGCTGCTGTGGCTGCTGGCA
AGCCGCGTCGGGGAAATTTTACCGCGCACGCTGATCGCCAGCGAAGTCTGGGGGATTAACTTTGACAGCGAAACCAACGT
GGTGGATGTCGCCATTCGTCGCCTGCGCAAAAAAATCGACGATCCGTTCCCGCTCAAGCTGATAGAAACCGTGCGCGGCA
TGGGTTATCGCCTTAACGCGCCGGAGCAGAGCGATGCGTAG

Protein sequence :
MKLLLIEDNDKTRAWLEKGLREAGLVVDTVADGRDGLHLALEQDYALIILDIMLPGLDGWQVLRALRTAKATPVLCLTAR
DAVSDRVKGLELGADDYLVKPFSFAELLARVRAQLRRHAPAAATLQVADLTLDTARHAASRGGERIALTRQEFTLLWLLA
SRVGEILPRTLIASEVWGINFDSETNVVDVAIRRLRKKIDDPFPLKLIETVRGMGYRLNAPEQSDA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-77 73
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-76 70

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ESA_04133 YP_001440151.1 transcriptional regulatory protein YedW BAC0197 Protein 1e-61 61
ESA_04133 YP_001440151.1 transcriptional regulatory protein YedW BAC0083 Protein 3e-62 60
ESA_04133 YP_001440151.1 transcriptional regulatory protein YedW BAC0125 Protein 4e-62 60
ESA_04133 YP_001440151.1 transcriptional regulatory protein YedW BAC0111 Protein 6e-61 59
ESA_04133 YP_001440151.1 transcriptional regulatory protein YedW BAC0638 Protein 5e-56 57
ESA_04133 YP_001440151.1 transcriptional regulatory protein YedW BAC0308 Protein 6e-56 57
ESA_04133 YP_001440151.1 transcriptional regulatory protein YedW BAC0347 Protein 4e-55 54
ESA_04133 YP_001440151.1 transcriptional regulatory protein YedW NC_010079.5776364.p0 Protein 4e-41 45
ESA_04133 YP_001440151.1 transcriptional regulatory protein YedW NC_002952.2859858.p0 Protein 4e-41 45
ESA_04133 YP_001440151.1 transcriptional regulatory protein YedW NC_007622.3794948.p0 Protein 4e-41 45
ESA_04133 YP_001440151.1 transcriptional regulatory protein YedW NC_003923.1003417.p0 Protein 4e-41 45
ESA_04133 YP_001440151.1 transcriptional regulatory protein YedW NC_013450.8614146.p0 Protein 4e-41 45
ESA_04133 YP_001440151.1 transcriptional regulatory protein YedW NC_002951.3238224.p0 Protein 4e-41 45
ESA_04133 YP_001440151.1 transcriptional regulatory protein YedW NC_007793.3914065.p0 Protein 4e-41 45
ESA_04133 YP_001440151.1 transcriptional regulatory protein YedW NC_002758.1121390.p0 Protein 4e-41 45
ESA_04133 YP_001440151.1 transcriptional regulatory protein YedW AE015929.1.gene1106. Protein 2e-35 43
ESA_04133 YP_001440151.1 transcriptional regulatory protein YedW CP001918.1.gene5135. Protein 3e-24 43
ESA_04133 YP_001440151.1 transcriptional regulatory protein YedW NC_012469.1.7685629. Protein 2e-33 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ESA_04133 YP_001440151.1 transcriptional regulatory protein YedW VFG0596 Protein 9e-78 73
ESA_04133 YP_001440151.1 transcriptional regulatory protein YedW VFG1389 Protein 2e-34 46
ESA_04133 YP_001440151.1 transcriptional regulatory protein YedW VFG1390 Protein 6e-38 44
ESA_04133 YP_001440151.1 transcriptional regulatory protein YedW VFG0473 Protein 9e-32 41