Gene Information

Name : ESA_01808 (ESA_01808)
Accession : YP_001437898.1
Strain : Cronobacter sakazakii ATCC BAA-894
Genome accession: NC_009778
Putative virulence/resistance : Resistance
Product : DNA-binding transcriptional activator MarA
Function : -
COG functional category : K : Transcription
COG ID : COG2207
EC number : -
Position : 1747121 - 1747495 bp
Length : 375 bp
Strand : -
Note : transcriptional activator of genes involved in the multiple antibiotic resistance (Mar) phenotype; also activates sodA, zwf and micF

DNA sequence : 
ATGTCCAGACGCAACAATGATGCCATTACTATTCATAGCATTTTGGACTGGATTGAAGATAACCTGGAATCCCCCCTTTC
CCTTGAGAAAGTGTCGGCGCGTTCGGGTTACTCGAAATGGCACCTGCAACGCATGTTCAAAAAAGAGACCGGTCACTCGC
TGGGCCAGTATATCCGCAACCGGAAACTGACCGAGATTGCCCTCAAACTCAAAGAGAGCGACGAACCGATTCTTTATCTG
GCCGAGCGCTATGGGTTTGAATCCCAGCAGACGCTGACCCGCACGTTTAAGAACTATTTCTCCGTGCCGCCGCATAAATA
TCGCGTGACGCGGATGCCGGGCGAAGGCAAGTACCTCCACCCGCTGAATCACTGA

Protein sequence : 
MSRRNNDAITIHSILDWIEDNLESPLSLEKVSARSGYSKWHLQRMFKKETGHSLGQYIRNRKLTEIALKLKESDEPILYL
AERYGFESQQTLTRTFKNYFSVPPHKYRVTRMPGEGKYLHPLNH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
tetD AAL08447.1 putative transcriptional regulator TetD Not tested SRL Protein 4e-21 45
tetD AEA34665.1 tetracycline resistance protein D Not tested Not named Protein 4e-21 45
soxS YP_219131.1 DNA-binding transcriptional regulator SoxS Not tested SPI-4 Protein 6e-20 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ESA_01808 YP_001437898.1 DNA-binding transcriptional activator MarA CP000647.1.gene1624. Protein 1e-51 90
ESA_01808 YP_001437898.1 DNA-binding transcriptional activator MarA CP001918.1.gene2033. Protein 4e-51 90
ESA_01808 YP_001437898.1 DNA-binding transcriptional activator MarA BAC0560 Protein 2e-51 90
ESA_01808 YP_001437898.1 DNA-binding transcriptional activator MarA NC_002695.1.917339.p Protein 2e-51 90
ESA_01808 YP_001437898.1 DNA-binding transcriptional activator MarA CP001138.1.gene1637. Protein 1e-50 89
ESA_01808 YP_001437898.1 DNA-binding transcriptional activator MarA CP000034.1.gene1596. Protein 2e-51 89
ESA_01808 YP_001437898.1 DNA-binding transcriptional activator MarA CP001138.1.gene612.p Protein 1e-22 47
ESA_01808 YP_001437898.1 DNA-binding transcriptional activator MarA NC_010558.1.6276025. Protein 2e-21 45
ESA_01808 YP_001437898.1 DNA-binding transcriptional activator MarA NC_002695.1.914293.p Protein 6e-20 42
ESA_01808 YP_001437898.1 DNA-binding transcriptional activator MarA CP001138.1.gene4488. Protein 2e-20 42
ESA_01808 YP_001437898.1 DNA-binding transcriptional activator MarA CP000034.1.gene4505. Protein 1e-19 42
ESA_01808 YP_001437898.1 DNA-binding transcriptional activator MarA BAC0371 Protein 6e-20 42
ESA_01808 YP_001437898.1 DNA-binding transcriptional activator MarA CP001918.1.gene327.p Protein 2e-19 41
ESA_01808 YP_001437898.1 DNA-binding transcriptional activator MarA CP000647.1.gene4499. Protein 3e-19 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ESA_01808 YP_001437898.1 DNA-binding transcriptional activator MarA VFG1038 Protein 2e-21 45
ESA_01808 YP_001437898.1 DNA-binding transcriptional activator MarA VFG0585 Protein 2e-20 42