Gene Information

Name : Rcas_0960 (Rcas_0960)
Accession : YP_001431091.1
Strain : Roseiflexus castenholzii DSM 13941
Genome accession: NC_009767
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1267196 - 1267906 bp
Length : 711 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: rrs:RoseRS_3485 two component transcriptional regulator, winged helix family

DNA sequence :
ATGAGCACGATTCTGGTTGTTGATGACGAGCCAGCGCTACGCGATATGCTCCGGCTCTATCTCGAACAAGAAGGCTTCCA
CGTCGTCGAAGCGGGCGACGGGAGGCGCGCGCTGTACGTGGCGCGCGTCGAAAAACCGGACCTGGTGATCCTTGACCTGA
TGATGCCGGAAATGGGCGGGTATGAATTCCTGCGCGCTTTCGCAAAAGAATCGCGCACGCCGGTGATTGTGCTGACGGCA
AAGATCGAGGACACCGACAAAATCCTGGGGCTGGAACTCGGCGCTGACGATTATGTCACCAAACCGTTCAATGTGCGCGA
GTTGATCGCCCGCATTCGCGCAGTTCTGCGTCGCACCCAGCAGGCGCCGCTCGAACCGGACGTGCTGCGCGCGGCTGATA
TTGTGCTCGACCGCACCGGGCGGACGGTGCGCGTCGGTGGACGATACATCGATCTCACACCATCGGAGTTTGCCATTCTG
GCAACCCTCATGGCGGCGCCGGGGCAGGTCTTCTCGCGGCTCGACCTGCTCGACCGCGTCTCTGGCGATGCCTTTGAAGG
CTCAGAGCGCACGATTGATGTGCATATCCGCAACCTGCGCGCCAAAATCGAAGACGATCCGCGCAATCCGCGCTATATTG
AGACTGTATATGGCATGGGGTACCGCTTTGCGCTGCCGCGCACGCCGGACCCGTCGAAGACAGGCGCGTGA

Protein sequence :
MSTILVVDDEPALRDMLRLYLEQEGFHVVEAGDGRRALYVARVEKPDLVILDLMMPEMGGYEFLRAFAKESRTPVIVLTA
KIEDTDKILGLELGADDYVTKPFNVRELIARIRAVLRRTQQAPLEPDVLRAADIVLDRTGRTVRVGGRYIDLTPSEFAIL
ATLMAAPGQVFSRLDLLDRVSGDAFEGSERTIDVHIRNLRAKIEDDPRNPRYIETVYGMGYRFALPRTPDPSKTGA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 6e-39 43
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 5e-39 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Rcas_0960 YP_001431091.1 two component transcriptional regulator HE999704.1.gene2815. Protein 2e-39 46
Rcas_0960 YP_001431091.1 two component transcriptional regulator AE000516.2.gene3505. Protein 7e-35 46
Rcas_0960 YP_001431091.1 two component transcriptional regulator CP000675.2.gene1535. Protein 2e-41 45
Rcas_0960 YP_001431091.1 two component transcriptional regulator AE016830.1.gene1681. Protein 2e-38 44
Rcas_0960 YP_001431091.1 two component transcriptional regulator NC_012469.1.7685629. Protein 3e-37 44
Rcas_0960 YP_001431091.1 two component transcriptional regulator FJ349556.1.orf0.gene Protein 6e-37 43
Rcas_0960 YP_001431091.1 two component transcriptional regulator BAC0125 Protein 3e-29 43
Rcas_0960 YP_001431091.1 two component transcriptional regulator NC_011595.7057856.p0 Protein 1e-38 42
Rcas_0960 YP_001431091.1 two component transcriptional regulator NC_010400.5986590.p0 Protein 5e-38 42
Rcas_0960 YP_001431091.1 two component transcriptional regulator NC_010410.6002989.p0 Protein 1e-38 42
Rcas_0960 YP_001431091.1 two component transcriptional regulator BAC0197 Protein 5e-31 42
Rcas_0960 YP_001431091.1 two component transcriptional regulator AF155139.2.orf0.gene Protein 2e-36 42
Rcas_0960 YP_001431091.1 two component transcriptional regulator CP000034.1.gene3834. Protein 3e-29 42
Rcas_0960 YP_001431091.1 two component transcriptional regulator NC_002695.1.915041.p Protein 3e-29 42
Rcas_0960 YP_001431091.1 two component transcriptional regulator CP004022.1.gene3215. Protein 5e-31 42
Rcas_0960 YP_001431091.1 two component transcriptional regulator AE015929.1.gene1106. Protein 8e-25 41
Rcas_0960 YP_001431091.1 two component transcriptional regulator NC_010079.5776364.p0 Protein 9e-28 41
Rcas_0960 YP_001431091.1 two component transcriptional regulator NC_002952.2859858.p0 Protein 9e-28 41
Rcas_0960 YP_001431091.1 two component transcriptional regulator NC_007622.3794948.p0 Protein 9e-28 41
Rcas_0960 YP_001431091.1 two component transcriptional regulator NC_003923.1003417.p0 Protein 9e-28 41
Rcas_0960 YP_001431091.1 two component transcriptional regulator NC_013450.8614146.p0 Protein 9e-28 41
Rcas_0960 YP_001431091.1 two component transcriptional regulator NC_002951.3238224.p0 Protein 9e-28 41
Rcas_0960 YP_001431091.1 two component transcriptional regulator NC_007793.3914065.p0 Protein 9e-28 41
Rcas_0960 YP_001431091.1 two component transcriptional regulator NC_002758.1121390.p0 Protein 9e-28 41
Rcas_0960 YP_001431091.1 two component transcriptional regulator CP000034.1.gene3671. Protein 1e-34 41
Rcas_0960 YP_001431091.1 two component transcriptional regulator BAC0533 Protein 8e-28 41
Rcas_0960 YP_001431091.1 two component transcriptional regulator AF130997.1.orf0.gene Protein 1e-29 41
Rcas_0960 YP_001431091.1 two component transcriptional regulator CP000647.1.gene4257. Protein 8e-28 41
Rcas_0960 YP_001431091.1 two component transcriptional regulator CP001485.1.gene721.p Protein 1e-32 41
Rcas_0960 YP_001431091.1 two component transcriptional regulator NC_012469.1.7686381. Protein 5e-35 41
Rcas_0960 YP_001431091.1 two component transcriptional regulator CP001918.1.gene3444. Protein 1e-35 41
Rcas_0960 YP_001431091.1 two component transcriptional regulator BAC0596 Protein 5e-35 41
Rcas_0960 YP_001431091.1 two component transcriptional regulator BAC0039 Protein 5e-35 41
Rcas_0960 YP_001431091.1 two component transcriptional regulator NC_002695.1.916589.p Protein 3e-35 41
Rcas_0960 YP_001431091.1 two component transcriptional regulator CP000647.1.gene2531. Protein 3e-36 41
Rcas_0960 YP_001431091.1 two component transcriptional regulator CP001138.1.gene2239. Protein 5e-35 41
Rcas_0960 YP_001431091.1 two component transcriptional regulator CP000034.1.gene2186. Protein 5e-35 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Rcas_0960 YP_001431091.1 two component transcriptional regulator VFG1390 Protein 7e-29 43
Rcas_0960 YP_001431091.1 two component transcriptional regulator VFG1702 Protein 2e-39 43
Rcas_0960 YP_001431091.1 two component transcriptional regulator VFG1563 Protein 3e-39 42