Gene Information

Name : Rcas_4445 (Rcas_4445)
Accession : YP_001434479.1
Strain : Roseiflexus castenholzii DSM 13941
Genome accession: NC_009767
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 5712968 - 5713657 bp
Length : 690 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: rrs:RoseRS_0761 two component transcriptional regulator, winged helix family

DNA sequence :
ATGCAGGGGAATGAGCAGCGTCGGATTCTGATCGTGGATGATGAGCCTGGTCTGCGTGATCTGCTGCGTATCAACCTCGA
GCATGAAGGATTCAGCGTGATTGAGGCTGAAAGCGGTGCTCAGGGATTACAGATGGTGCGTGACCAACATCCCGATCTGA
TGATCCTCGATGTAATGATGCCGGAAATGGACGGATGGGAGGTCTGTCGGCGGTTGCGCGAGTTCTCACAGATGCCGGTG
TTGATGCTGACAGCGCGTACACAGAGCAAGGATATCGTCACCGGGCTTGAAAGCGGCGCCGATGATTACTTGACCAAGCC
GTTCAATATGGACGAGTTGACGGCGCGCATTCGAGCGCTGCTGCGACGGGTGCCCTCTCCCAATCGCCCGATCGTCGCTG
GCGGCGGCGAAATCATGATCGACAAGCAGAAGCGTGAGGTGCTGGTGCGTGGCGAGCCGGTCGATCTGACGCCAACCGAG
TACGATCTGCTTCTCCTGCTTGCCGAACATGCCGGCGCGGTGCTCGATCACGAAACACTTCTACGCGGCGTGTGGGGGCA
TGAGTATACGAAGGACAACGACTATCTCAAAGTCTATATCTGGCATCTGCGCCGCAAAATTGAACAGGACCCGCGTGAAC
CGAAATTGCTGCTGACTGAATGGGGAGTCGGGTATCGTCTGGCGCCGTGA

Protein sequence :
MQGNEQRRILIVDDEPGLRDLLRINLEHEGFSVIEAESGAQGLQMVRDQHPDLMILDVMMPEMDGWEVCRRLREFSQMPV
LMLTARTQSKDIVTGLESGADDYLTKPFNMDELTARIRALLRRVPSPNRPIVAGGGEIMIDKQKREVLVRGEPVDLTPTE
YDLLLLLAEHAGAVLDHETLLRGVWGHEYTKDNDYLKVYIWHLRRKIEQDPREPKLLLTEWGVGYRLAP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 4e-36 42
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-31 41
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 2e-35 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Rcas_4445 YP_001434479.1 two component transcriptional regulator NC_010079.5776364.p0 Protein 1e-38 43
Rcas_4445 YP_001434479.1 two component transcriptional regulator NC_002952.2859858.p0 Protein 1e-38 43
Rcas_4445 YP_001434479.1 two component transcriptional regulator NC_007622.3794948.p0 Protein 1e-38 43
Rcas_4445 YP_001434479.1 two component transcriptional regulator NC_003923.1003417.p0 Protein 1e-38 43
Rcas_4445 YP_001434479.1 two component transcriptional regulator NC_013450.8614146.p0 Protein 1e-38 43
Rcas_4445 YP_001434479.1 two component transcriptional regulator NC_002951.3238224.p0 Protein 1e-38 43
Rcas_4445 YP_001434479.1 two component transcriptional regulator NC_007793.3914065.p0 Protein 1e-38 43
Rcas_4445 YP_001434479.1 two component transcriptional regulator NC_002758.1121390.p0 Protein 1e-38 43
Rcas_4445 YP_001434479.1 two component transcriptional regulator AE016830.1.gene1681. Protein 3e-40 43
Rcas_4445 YP_001434479.1 two component transcriptional regulator BAC0083 Protein 3e-33 43
Rcas_4445 YP_001434479.1 two component transcriptional regulator AF155139.2.orf0.gene Protein 2e-40 43
Rcas_4445 YP_001434479.1 two component transcriptional regulator FJ349556.1.orf0.gene Protein 3e-40 43
Rcas_4445 YP_001434479.1 two component transcriptional regulator CP004022.1.gene3215. Protein 1e-26 43
Rcas_4445 YP_001434479.1 two component transcriptional regulator CP000034.1.gene3834. Protein 8e-22 43
Rcas_4445 YP_001434479.1 two component transcriptional regulator NC_002695.1.915041.p Protein 8e-22 43
Rcas_4445 YP_001434479.1 two component transcriptional regulator AE015929.1.gene1106. Protein 6e-33 42
Rcas_4445 YP_001434479.1 two component transcriptional regulator CP000675.2.gene1535. Protein 4e-32 42
Rcas_4445 YP_001434479.1 two component transcriptional regulator BAC0125 Protein 5e-32 42
Rcas_4445 YP_001434479.1 two component transcriptional regulator BAC0308 Protein 2e-32 42
Rcas_4445 YP_001434479.1 two component transcriptional regulator HE999704.1.gene2815. Protein 6e-39 42
Rcas_4445 YP_001434479.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 3e-38 42
Rcas_4445 YP_001434479.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 5e-38 42
Rcas_4445 YP_001434479.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 3e-38 42
Rcas_4445 YP_001434479.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 5e-38 42
Rcas_4445 YP_001434479.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 3e-38 42
Rcas_4445 YP_001434479.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 5e-38 42
Rcas_4445 YP_001434479.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 5e-38 42
Rcas_4445 YP_001434479.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 5e-38 42
Rcas_4445 YP_001434479.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 5e-38 42
Rcas_4445 YP_001434479.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 5e-38 42
Rcas_4445 YP_001434479.1 two component transcriptional regulator NC_012469.1.7685629. Protein 3e-36 42
Rcas_4445 YP_001434479.1 two component transcriptional regulator BAC0197 Protein 8e-30 42
Rcas_4445 YP_001434479.1 two component transcriptional regulator CP000647.1.gene4257. Protein 6e-22 42
Rcas_4445 YP_001434479.1 two component transcriptional regulator CP001138.1.gene4273. Protein 1e-21 42
Rcas_4445 YP_001434479.1 two component transcriptional regulator BAC0533 Protein 6e-22 42
Rcas_4445 YP_001434479.1 two component transcriptional regulator HE999704.1.gene1528. Protein 2e-31 41
Rcas_4445 YP_001434479.1 two component transcriptional regulator CP001485.1.gene721.p Protein 1e-28 41
Rcas_4445 YP_001434479.1 two component transcriptional regulator BAC0638 Protein 7e-30 41
Rcas_4445 YP_001434479.1 two component transcriptional regulator AE000516.2.gene3505. Protein 2e-36 41
Rcas_4445 YP_001434479.1 two component transcriptional regulator CP001918.1.gene5135. Protein 6e-17 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Rcas_4445 YP_001434479.1 two component transcriptional regulator VFG1390 Protein 9e-40 44
Rcas_4445 YP_001434479.1 two component transcriptional regulator VFG1386 Protein 5e-38 43
Rcas_4445 YP_001434479.1 two component transcriptional regulator VFG1389 Protein 6e-32 43
Rcas_4445 YP_001434479.1 two component transcriptional regulator VFG1702 Protein 2e-36 42
Rcas_4445 YP_001434479.1 two component transcriptional regulator VFG0596 Protein 5e-32 41
Rcas_4445 YP_001434479.1 two component transcriptional regulator VFG1563 Protein 9e-36 41