Gene Information

Name : Rcas_0353 (Rcas_0353)
Accession : YP_001430503.1
Strain : Roseiflexus castenholzii DSM 13941
Genome accession: NC_009767
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 437101 - 437793 bp
Length : 693 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: rrs:RoseRS_0114 two component transcriptional regulator, winged helix family

DNA sequence :
ATGGCCGCAACAATCCTCGTTGTTGAGGATGAGGAGCCGATTCTCAACCTTGTCGTCGCCTACCTGAAGGCGGATGGGTT
CGCCGTACACACTGCGCGCGATGGTGAGTCGGCGCTGATGCTGGCGCAGACACTGCAACCCGATCTGATCGTTCTCGATC
TGTTGCTGCCCGGAATGGACGGTCTTGAAATTTGCCGACGCTTGCAGCGCGATGGCGGTCCGTATGTGCTCATGCTGACC
GCGCGCGCCGAGGAGGTCGATAAGGTCGTGGGGCTGTCCGTCGGCGCCGATGATTACCTGACCAAGCCGTTCAGTCCACG
CGAGTTGGTGGCGCGTGTCAAGGCCATCCTGCGCCGGCGACGCCATACGAGTGTCGCTTCTCCAGCCGAGTCCGCCCTGT
TGACCTTTCGTGACCTCCAGATCGATGTTGCGCGGCGCGAGGTGCAGCGTCGCGGCGTGCCGGTCACGTTGACGGCGCGC
GAGTTCGATCTGCTCTATACGCTGGCTGCCATGCCGGGGCGTGTGTTTACGCGTGAGCAACTGCTCGAACGGGTTTGGGG
ACACGATTTCGATGGCGTGGATCGAGTGGTCGATGTCCATATCAGTTTGCTGCGGAGGAAACTGGAGGATGATCCGACGG
AACCGACCCTGATCCAGACGGTGCGTGGCGTCGGATACAAATTCACCGGGTAA

Protein sequence :
MAATILVVEDEEPILNLVVAYLKADGFAVHTARDGESALMLAQTLQPDLIVLDLLLPGMDGLEICRRLQRDGGPYVLMLT
ARAEEVDKVVGLSVGADDYLTKPFSPRELVARVKAILRRRRHTSVASPAESALLTFRDLQIDVARREVQRRGVPVTLTAR
EFDLLYTLAAMPGRVFTREQLLERVWGHDFDGVDRVVDVHISLLRRKLEDDPTEPTLIQTVRGVGYKFTG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 3e-36 43
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 5e-36 43
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-26 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-26 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Rcas_0353 YP_001430503.1 two component transcriptional regulator AE016830.1.gene1681. Protein 6e-42 49
Rcas_0353 YP_001430503.1 two component transcriptional regulator HE999704.1.gene2815. Protein 5e-38 49
Rcas_0353 YP_001430503.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 1e-40 48
Rcas_0353 YP_001430503.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 9e-41 48
Rcas_0353 YP_001430503.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 9e-41 48
Rcas_0353 YP_001430503.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 9e-41 48
Rcas_0353 YP_001430503.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 1e-40 48
Rcas_0353 YP_001430503.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 9e-41 48
Rcas_0353 YP_001430503.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 9e-41 48
Rcas_0353 YP_001430503.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 9e-41 48
Rcas_0353 YP_001430503.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 8e-41 48
Rcas_0353 YP_001430503.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 9e-41 48
Rcas_0353 YP_001430503.1 two component transcriptional regulator NC_012469.1.7685629. Protein 8e-36 47
Rcas_0353 YP_001430503.1 two component transcriptional regulator NC_012469.1.7686381. Protein 2e-43 46
Rcas_0353 YP_001430503.1 two component transcriptional regulator AE000516.2.gene3505. Protein 2e-36 46
Rcas_0353 YP_001430503.1 two component transcriptional regulator BAC0197 Protein 2e-28 45
Rcas_0353 YP_001430503.1 two component transcriptional regulator NC_011595.7057856.p0 Protein 3e-32 44
Rcas_0353 YP_001430503.1 two component transcriptional regulator NC_010400.5986590.p0 Protein 1e-32 44
Rcas_0353 YP_001430503.1 two component transcriptional regulator NC_010410.6002989.p0 Protein 3e-32 44
Rcas_0353 YP_001430503.1 two component transcriptional regulator BAC0596 Protein 1e-33 44
Rcas_0353 YP_001430503.1 two component transcriptional regulator BAC0039 Protein 5e-34 44
Rcas_0353 YP_001430503.1 two component transcriptional regulator CP000647.1.gene2531. Protein 2e-33 44
Rcas_0353 YP_001430503.1 two component transcriptional regulator CP001138.1.gene2239. Protein 1e-33 44
Rcas_0353 YP_001430503.1 two component transcriptional regulator CP000034.1.gene2186. Protein 5e-34 44
Rcas_0353 YP_001430503.1 two component transcriptional regulator NC_002695.1.916589.p Protein 4e-34 44
Rcas_0353 YP_001430503.1 two component transcriptional regulator CP001918.1.gene3444. Protein 4e-33 43
Rcas_0353 YP_001430503.1 two component transcriptional regulator CP000034.1.gene3671. Protein 1e-39 43
Rcas_0353 YP_001430503.1 two component transcriptional regulator NC_008702.1.4607594. Protein 1e-31 43
Rcas_0353 YP_001430503.1 two component transcriptional regulator AF130997.1.orf0.gene Protein 2e-32 42
Rcas_0353 YP_001430503.1 two component transcriptional regulator BAC0308 Protein 3e-23 42
Rcas_0353 YP_001430503.1 two component transcriptional regulator BAC0125 Protein 6e-27 42
Rcas_0353 YP_001430503.1 two component transcriptional regulator BAC0111 Protein 8e-25 41
Rcas_0353 YP_001430503.1 two component transcriptional regulator NC_005054.2598277.p0 Protein 3e-34 41
Rcas_0353 YP_001430503.1 two component transcriptional regulator NC_014475.1.orf0.gen Protein 3e-34 41
Rcas_0353 YP_001430503.1 two component transcriptional regulator DQ212986.1.gene4.p01 Protein 1e-33 41
Rcas_0353 YP_001430503.1 two component transcriptional regulator AF162694.1.orf4.gene Protein 1e-30 41
Rcas_0353 YP_001430503.1 two component transcriptional regulator FJ349556.1.orf0.gene Protein 1e-37 41
Rcas_0353 YP_001430503.1 two component transcriptional regulator AF155139.2.orf0.gene Protein 3e-39 41
Rcas_0353 YP_001430503.1 two component transcriptional regulator HE999704.1.gene1528. Protein 8e-27 41
Rcas_0353 YP_001430503.1 two component transcriptional regulator CP001485.1.gene721.p Protein 6e-30 41
Rcas_0353 YP_001430503.1 two component transcriptional regulator NC_002695.1.915041.p Protein 2e-28 41
Rcas_0353 YP_001430503.1 two component transcriptional regulator CP001138.1.gene4273. Protein 7e-29 41
Rcas_0353 YP_001430503.1 two component transcriptional regulator BAC0533 Protein 4e-29 41
Rcas_0353 YP_001430503.1 two component transcriptional regulator CP000034.1.gene3834. Protein 2e-28 41
Rcas_0353 YP_001430503.1 two component transcriptional regulator CP000647.1.gene4257. Protein 4e-29 41
Rcas_0353 YP_001430503.1 two component transcriptional regulator CP001918.1.gene5135. Protein 7e-26 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Rcas_0353 YP_001430503.1 two component transcriptional regulator VFG1389 Protein 1e-29 49
Rcas_0353 YP_001430503.1 two component transcriptional regulator VFG1390 Protein 2e-34 46
Rcas_0353 YP_001430503.1 two component transcriptional regulator VFG1386 Protein 2e-32 44
Rcas_0353 YP_001430503.1 two component transcriptional regulator VFG1563 Protein 2e-36 43
Rcas_0353 YP_001430503.1 two component transcriptional regulator VFG1702 Protein 2e-36 43
Rcas_0353 YP_001430503.1 two component transcriptional regulator VFG0596 Protein 1e-26 42