Gene Information

Name : Rcas_2782 (Rcas_2782)
Accession : YP_001432871.1
Strain : Roseiflexus castenholzii DSM 13941
Genome accession: NC_009767
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3599167 - 3599862 bp
Length : 696 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: rrs:RoseRS_0114 two component transcriptional regulator, winged helix family

DNA sequence :
ATGATAGCAAGAACGTTGTTGATCGTCGAAGACGAAGATCGTCTGCGCAATTTGTTGCGCGGCTACCTGGAACGCGAAGG
ATTTCGCATCGTGCAGGCGCGTGATGGTGTACAGGCACTGAGCCTGGCGCGCAGCGAACAACCGGACCTGATCATCCTTG
ATCTGATGCTGCCTGGCATTGATGGGCTAGAAGTATGCCACAGGCTGCGCACATTCTCGGATGCCTACGTGCTGATGCTA
ACGGCGAAAGCCGAGGAGATGGATCGCGTCGTCGGGCTGGAGATCGGGGCCGACGACTACCTCACCAAGCCGTTCTCACC
GCGCGAACTGGTAGCGCGGGTACGTGCGATGTTTCGTCGTCCCCGCCATGCTGACGACGAGCCGGCGCCGCTGTTGGTGC
AGTCTGGACCGCTGACGATTGATGTTGCCCGTCATGAAGCGTTGCTTGCGGGCGAGCCGCTCAAACTGACCAATCTGGAG
TATGCATTGCTCAGCGTCCTGGCTTCGGCGCCTGGTCGTGTTTTTACCCGCGCGCAATTGATCGAGCGGGTATGGGGCAA
CGACTACTTTGGCGATGATCACGTTATCGATGTGCATATCGCCAATCTGCGGAAGAAACTGGGGGATGATCCGACGCGAC
CGACGTTCATCATGACGGTGCGCGGCATAGGCTATCGGTTTGGAGACGCATCGTGA

Protein sequence :
MIARTLLIVEDEDRLRNLLRGYLEREGFRIVQARDGVQALSLARSEQPDLIILDLMLPGIDGLEVCHRLRTFSDAYVLML
TAKAEEMDRVVGLEIGADDYLTKPFSPRELVARVRAMFRRPRHADDEPAPLLVQSGPLTIDVARHEALLAGEPLKLTNLE
YALLSVLASAPGRVFTRAQLIERVWGNDYFGDDHVIDVHIANLRKKLGDDPTRPTFIMTVRGIGYRFGDAS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-29 41
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 6e-38 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 4e-37 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Rcas_2782 YP_001432871.1 two component transcriptional regulator NC_012469.1.7685629. Protein 5e-46 48
Rcas_2782 YP_001432871.1 two component transcriptional regulator AE000516.2.gene3505. Protein 3e-41 48
Rcas_2782 YP_001432871.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 2e-44 46
Rcas_2782 YP_001432871.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 2e-44 46
Rcas_2782 YP_001432871.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 2e-44 46
Rcas_2782 YP_001432871.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 2e-44 46
Rcas_2782 YP_001432871.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 2e-44 46
Rcas_2782 YP_001432871.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 2e-44 46
Rcas_2782 YP_001432871.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 2e-44 46
Rcas_2782 YP_001432871.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 2e-44 46
Rcas_2782 YP_001432871.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 2e-44 46
Rcas_2782 YP_001432871.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 2e-44 46
Rcas_2782 YP_001432871.1 two component transcriptional regulator NC_002695.1.916589.p Protein 4e-42 46
Rcas_2782 YP_001432871.1 two component transcriptional regulator CP000647.1.gene2531. Protein 2e-42 46
Rcas_2782 YP_001432871.1 two component transcriptional regulator AE016830.1.gene1681. Protein 3e-46 45
Rcas_2782 YP_001432871.1 two component transcriptional regulator HE999704.1.gene2815. Protein 1e-45 45
Rcas_2782 YP_001432871.1 two component transcriptional regulator CP001138.1.gene2239. Protein 5e-42 45
Rcas_2782 YP_001432871.1 two component transcriptional regulator BAC0039 Protein 5e-42 45
Rcas_2782 YP_001432871.1 two component transcriptional regulator BAC0596 Protein 5e-42 45
Rcas_2782 YP_001432871.1 two component transcriptional regulator CP001918.1.gene3444. Protein 3e-42 45
Rcas_2782 YP_001432871.1 two component transcriptional regulator CP000034.1.gene2186. Protein 5e-42 45
Rcas_2782 YP_001432871.1 two component transcriptional regulator CP000675.2.gene1535. Protein 3e-43 44
Rcas_2782 YP_001432871.1 two component transcriptional regulator NC_012469.1.7686381. Protein 7e-45 44
Rcas_2782 YP_001432871.1 two component transcriptional regulator CP004022.1.gene3215. Protein 5e-37 44
Rcas_2782 YP_001432871.1 two component transcriptional regulator CP001485.1.gene721.p Protein 3e-36 44
Rcas_2782 YP_001432871.1 two component transcriptional regulator BAC0197 Protein 6e-31 44
Rcas_2782 YP_001432871.1 two component transcriptional regulator CP001918.1.gene5135. Protein 1e-28 43
Rcas_2782 YP_001432871.1 two component transcriptional regulator NC_008702.1.4607594. Protein 4e-37 43
Rcas_2782 YP_001432871.1 two component transcriptional regulator NC_011595.7057856.p0 Protein 4e-38 42
Rcas_2782 YP_001432871.1 two component transcriptional regulator NC_010400.5986590.p0 Protein 3e-37 42
Rcas_2782 YP_001432871.1 two component transcriptional regulator NC_010410.6002989.p0 Protein 4e-38 42
Rcas_2782 YP_001432871.1 two component transcriptional regulator BAC0308 Protein 1e-29 42
Rcas_2782 YP_001432871.1 two component transcriptional regulator CP001138.1.gene4273. Protein 2e-32 42
Rcas_2782 YP_001432871.1 two component transcriptional regulator CP004022.1.gene1676. Protein 4e-38 42
Rcas_2782 YP_001432871.1 two component transcriptional regulator CP000034.1.gene3671. Protein 7e-42 42
Rcas_2782 YP_001432871.1 two component transcriptional regulator NC_013450.8614146.p0 Protein 3e-33 41
Rcas_2782 YP_001432871.1 two component transcriptional regulator NC_002951.3238224.p0 Protein 3e-33 41
Rcas_2782 YP_001432871.1 two component transcriptional regulator NC_007793.3914065.p0 Protein 3e-33 41
Rcas_2782 YP_001432871.1 two component transcriptional regulator NC_002758.1121390.p0 Protein 3e-33 41
Rcas_2782 YP_001432871.1 two component transcriptional regulator NC_010079.5776364.p0 Protein 3e-33 41
Rcas_2782 YP_001432871.1 two component transcriptional regulator NC_002952.2859858.p0 Protein 3e-33 41
Rcas_2782 YP_001432871.1 two component transcriptional regulator NC_007622.3794948.p0 Protein 3e-33 41
Rcas_2782 YP_001432871.1 two component transcriptional regulator NC_003923.1003417.p0 Protein 3e-33 41
Rcas_2782 YP_001432871.1 two component transcriptional regulator BAC0083 Protein 3e-29 41
Rcas_2782 YP_001432871.1 two component transcriptional regulator BAC0125 Protein 4e-29 41
Rcas_2782 YP_001432871.1 two component transcriptional regulator CP000034.1.gene3834. Protein 9e-33 41
Rcas_2782 YP_001432871.1 two component transcriptional regulator NC_002695.1.915041.p Protein 9e-33 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Rcas_2782 YP_001432871.1 two component transcriptional regulator VFG1389 Protein 6e-32 43
Rcas_2782 YP_001432871.1 two component transcriptional regulator VFG0596 Protein 6e-30 41
Rcas_2782 YP_001432871.1 two component transcriptional regulator VFG1390 Protein 7e-38 41
Rcas_2782 YP_001432871.1 two component transcriptional regulator VFG1563 Protein 4e-38 41
Rcas_2782 YP_001432871.1 two component transcriptional regulator VFG1702 Protein 2e-37 41