Gene Information

Name : Xaut_4609 (Xaut_4609)
Accession : YP_001419487.1
Strain : Xanthobacter autotrophicus Py2
Genome accession: NC_009720
Putative virulence/resistance : Unknown
Product : IS66 Orf2 family protein
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG3436
EC number : -
Position : 5095691 - 5096038 bp
Length : 348 bp
Strand : -
Note : PFAM: IS66 Orf2 family protein; KEGG: mag:amb0402 transposase and inactivated derivative

DNA sequence :
ATGATCCCGGTCCCGAGCGGCGTGAAGGTGTGGCTTGCGACGGGCCACACCGATATGCGCAAGGGCTTCGCCGGGCTTTC
GCTGCAGGTCCAGGAGGTTCTTCGGCATGATCCCCATGGCGGGCACCTGTTCGTGTTCCGCGGTCGGCGCGGTGACCTCA
TCAAGGTGATCTGGCATGACGGCCAGGGCGCCTGCCTGTTCTCGAAGCGGCTGGAGCGGGGCCGCTTCCTGTGGCCCTCG
CCGGCTGATGGGGTGGTGACGATCACTCCGGCCCAGCTCGGCTATCTCCTGGAGGGCATCGATTGGCGGCATCCGCAGCA
GGCGTGGAGACCGGGCGCGTCGGGGTGA

Protein sequence :
MIPVPSGVKVWLATGHTDMRKGFAGLSLQVQEVLRHDPHGGHLFVFRGRRGDLIKVIWHDGQGACLFSKRLERGRFLWPS
PADGVVTITPAQLGYLLEGIDWRHPQQAWRPGASG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 9e-34 62
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 9e-34 62
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 2e-33 61
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 3e-31 61
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 3e-31 61
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 1e-30 60
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 1e-30 60
unnamed AAC31493.1 L0014 Not tested LEE Protein 7e-31 60
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 1e-30 60
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 7e-31 60
unnamed AAL99258.1 unknown Not tested LEE Protein 7e-31 60
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 7e-31 60
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 1e-30 60
l0014 CAD33776.1 L0014 protein Not tested PAI I 536 Protein 2e-24 59
unnamed AAL08461.1 unknown Not tested SRL Protein 1e-30 59
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 5e-30 59
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 5e-30 59
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 2e-27 58
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 5e-31 57
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 5e-31 57
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 1e-30 56
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 1e-30 56
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 6e-31 56
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 3e-30 56
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 3e-30 56

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Xaut_4609 YP_001419487.1 IS66 Orf2 family protein VFG1665 Protein 8e-34 61
Xaut_4609 YP_001419487.1 IS66 Orf2 family protein VFG1698 Protein 7e-32 61
Xaut_4609 YP_001419487.1 IS66 Orf2 family protein VFG1709 Protein 3e-31 60
Xaut_4609 YP_001419487.1 IS66 Orf2 family protein VFG0792 Protein 3e-31 60
Xaut_4609 YP_001419487.1 IS66 Orf2 family protein VFG1517 Protein 9e-25 59
Xaut_4609 YP_001419487.1 IS66 Orf2 family protein VFG1052 Protein 5e-31 59
Xaut_4609 YP_001419487.1 IS66 Orf2 family protein VFG1737 Protein 2e-31 56