Gene Information

Name : Xaut_4597 (Xaut_4597)
Accession : YP_001419475.1
Strain : Xanthobacter autotrophicus Py2
Genome accession: NC_009720
Putative virulence/resistance : Unknown
Product : IS66 Orf2 family protein
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG3436
EC number : -
Position : 5083585 - 5083908 bp
Length : 324 bp
Strand : +
Note : PFAM: IS66 Orf2 family protein; KEGG: rle:RL2136 putative transposase-related protein

DNA sequence :
GTGGCGACACGGCCTGTGGACTTCCGTAAGGGGGCAGAGGGCCTTGCCGCTTTGGTGCGCGAGACCATGGGCGCCGATCC
GTTCTCCGGCACGGTGTACGTGTTCCGGGCCAAGCGAGCGGACCGGGTGAAGCTGGTGTTCTGGGACGGCACCGGCGTCG
TGCTGGTGGCGAAGCGGCTTGAGGACGGGGAGTTCCGCTGGCCGAAGATCGAGGACGGCACCCTGCAGCTGACGTCGGCC
CAGCTCCAGGCCTTGCTCGAGGGGCTCGACTGGCGGCGGGTCCATGAGGTGCAGCGCAGGGCGACACCCGTCGCCGCCAG
CTGA

Protein sequence :
MATRPVDFRKGAEGLAALVRETMGADPFSGTVYVFRAKRADRVKLVFWDGTGVVLVAKRLEDGEFRWPKIEDGTLQLTSA
QLQALLEGLDWRRVHEVQRRATPVAAS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 2e-11 51
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 2e-11 51
unnamed AAC31493.1 L0014 Not tested LEE Protein 2e-11 50
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 2e-11 50
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 3e-11 50
unnamed AAL99258.1 unknown Not tested LEE Protein 2e-11 50
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 3e-11 50
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 2e-11 50
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 3e-11 50
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 3e-11 50
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 3e-11 50
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 3e-11 50
unnamed AAL08461.1 unknown Not tested SRL Protein 4e-11 48
BCAM0247 YP_002232879.1 putative transposase Not tested BcenGI11 Protein 9e-15 47
EXB18 ABD94704.1 ISPpu14 transposase Orf2 Not tested ExoU island B Protein 3e-07 46
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 3e-12 44
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 3e-12 44
pB171ORF50 CAD66190.1 ORF50 protein of pB171 Not tested PAI III 536 Protein 8e-12 43
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 5e-10 42
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 5e-10 42
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 2e-12 41
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 2e-12 41
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 6e-13 41
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 6e-13 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Xaut_4597 YP_001419475.1 IS66 Orf2 family protein VFG1698 Protein 5e-12 51
Xaut_4597 YP_001419475.1 IS66 Orf2 family protein VFG0792 Protein 7e-12 50
Xaut_4597 YP_001419475.1 IS66 Orf2 family protein VFG1709 Protein 7e-12 50
Xaut_4597 YP_001419475.1 IS66 Orf2 family protein VFG1052 Protein 2e-11 48
Xaut_4597 YP_001419475.1 IS66 Orf2 family protein VFG1665 Protein 3e-12 43