Gene Information

Name : Xaut_3176 (Xaut_3176)
Accession : YP_001418063.1
Strain : Xanthobacter autotrophicus Py2
Genome accession: NC_009720
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3521523 - 3522194 bp
Length : 672 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: bbt:BBta_3067 putative two-component transcriptional regulator

DNA sequence :
GTGCGTCTTTTGGTGGTCGAGGACGATCCCGAGCTGAACCGACAGCTGGTCGAGGCCCTGTCCGACGCGGGCTATGCGGT
GGATCGCGCCTATGACGGCGAGGAGGGGCAGTATCTGGGCGAGACCGAGCCCTACGACGCCATCGTCCTCGACATCGGCC
TGCCCAAGCTCGACGGCATCTCGGTGCTGGAGAGCTGGCGCCGCGCCGGCAAGGTCACGCCGGTGCTGATCCTCACCGCC
CGCGATCGCTGGAGCGACAAGGTGCAGGGCTTCGATGCCGGCGCCGACGACTATGTGGCCAAGCCGTTCCACATGGAGGA
GGTTCTGGCCCGCCTGCGCGCCCTGCTGCGCCGCGCCTCCGGCCACGCTTCCAGCGAGATGACCTGCGGGCCGGTGCGGC
TCGACACCCGCTCCGGCCGGGTCACGGTGGAGGGCACTGCGGTCAAGCTCACCTCCCATGAATACCGGCTGCTGAGCTAT
CTCATGCACCATGCCGGGCGCGTGGTGTCGCGCGGGGAGCTGGTGGAGCACCTCTACGACCAGGATTTCGATCGCGATTC
CAACACCATCGAGGTGTTCGTCGGGCGCCTGCGCAAGAAGCTCGACTGCGACGTGATCCAGACCGTGCGCGGCCTCGGCT
ATCTGCTGGCCGCGCCGGAGGGGCAGCGCTAA

Protein sequence :
MRLLVVEDDPELNRQLVEALSDAGYAVDRAYDGEEGQYLGETEPYDAIVLDIGLPKLDGISVLESWRRAGKVTPVLILTA
RDRWSDKVQGFDAGADDYVAKPFHMEEVLARLRALLRRASGHASSEMTCGPVRLDTRSGRVTVEGTAVKLTSHEYRLLSY
LMHHAGRVVSRGELVEHLYDQDFDRDSNTIEVFVGRLRKKLDCDVIQTVRGLGYLLAAPEGQR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
armR AAN62112.1 putative response-regulator ArmR Not tested PAGI-2(C) Protein 1e-27 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Xaut_3176 YP_001418063.1 two component transcriptional regulator NC_002516.2.879194.p Protein 6e-40 49
Xaut_3176 YP_001418063.1 two component transcriptional regulator BAC0530 Protein 2e-36 48
Xaut_3176 YP_001418063.1 two component transcriptional regulator CP000647.1.gene1136. Protein 3e-36 47
Xaut_3176 YP_001418063.1 two component transcriptional regulator NC_002695.1.913289.p Protein 4e-36 46
Xaut_3176 YP_001418063.1 two component transcriptional regulator CP001918.1.gene2526. Protein 8e-36 46
Xaut_3176 YP_001418063.1 two component transcriptional regulator CP000034.1.gene2022. Protein 8e-37 46
Xaut_3176 YP_001418063.1 two component transcriptional regulator CP001138.1.gene1939. Protein 5e-37 46
Xaut_3176 YP_001418063.1 two component transcriptional regulator CP004022.1.gene1005. Protein 1e-37 45
Xaut_3176 YP_001418063.1 two component transcriptional regulator BAC0487 Protein 3e-29 44
Xaut_3176 YP_001418063.1 two component transcriptional regulator BAC0111 Protein 6e-31 43
Xaut_3176 YP_001418063.1 two component transcriptional regulator BAC0197 Protein 3e-31 42
Xaut_3176 YP_001418063.1 two component transcriptional regulator BAC0125 Protein 4e-30 41
Xaut_3176 YP_001418063.1 two component transcriptional regulator BAC0308 Protein 8e-27 41
Xaut_3176 YP_001418063.1 two component transcriptional regulator BAC0083 Protein 1e-29 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Xaut_3176 YP_001418063.1 two component transcriptional regulator VFG0475 Protein 4e-37 46
Xaut_3176 YP_001418063.1 two component transcriptional regulator VFG0473 Protein 8e-28 43
Xaut_3176 YP_001418063.1 two component transcriptional regulator VFG1390 Protein 2e-27 43
Xaut_3176 YP_001418063.1 two component transcriptional regulator VFG1389 Protein 8e-27 42