Gene Information

Name : Plav_0399 (Plav_0399)
Accession : YP_001411679.1
Strain : Parvibaculum lavamentivorans DS-1
Genome accession: NC_009719
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 432650 - 433468 bp
Length : 819 bp
Strand : +
Note : TIGRFAM: phosphate regulon transcriptional regulatory protein PhoB; PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: mmr:Mmar10_0483 two component transcriptional regulator, winged helix family

DNA sequence : 
ATGGCAATAACAACACTTGCCCGTCGTGGCGAACAGGGCCACGCTTTGGACTTGGAACAGATTCGGCCTGAGACCGCTCA
CACAGAGCAGGGTCAGCCTGAGCGCAGCCAGTTCGAACGCAGAATGAAACCGAGCGTCATGATCGTCGAGGATGAAGAAG
CGTTGCTGACGCTGCTTCAGTACAATCTCGACAAGGAAGGCTACAAGGTCATCACCGCCGCCGATGGCGAGGAGGCGGAC
CTGCTTATCCGCGAGACGACCCCCGACCTTATCCTGCTCGACTGGATGCTGCCGGGCCTCTCCGGCATCGAGCTTTGCCG
CCGCCTGCGCGGCCGCCCCGAAACCCGCAATGTGCCGATCATCATGATTACGGCGCGCGGCGAGGAAACGGACCGCATTC
GCGGCCTCGATATCGGCGCCGACGACTATGTAACGAAGCCCTTCTCGATGACGGAACTGCTGGCGCGCATCCGCGCCGTC
ATGCGCCGCATCCGGCCGGCCCTCACGGAAGACCTCGTGACCTTTGGCGACATCGTGATCGACCGCGCCGCCCACCGGGT
GCGCAGGGGCGACCGCGAGGTCCATCTCGGCCCGACCGAATACCGCCTGCTCGATCACCTGATCCAGCATCCCGGCCGGG
TCTTCAGCCGCGAGCAATTGCTGGATACGGTCTGGGGCTCGGATGTCTATGTCGAAGCCCGCACCGTCGACGTTCATGTC
GGCCGGCTGCGCAAGGCGCTTAACGACAAGGGCGAGAAAGACCCGATCCGCACGGTCCGTTCCGCCGGCTACTCGCTGGA
CGAGCAGTTCCACGAATAG

Protein sequence : 
MAITTLARRGEQGHALDLEQIRPETAHTEQGQPERSQFERRMKPSVMIVEDEEALLTLLQYNLDKEGYKVITAADGEEAD
LLIRETTPDLILLDWMLPGLSGIELCRRLRGRPETRNVPIIMITARGEETDRIRGLDIGADDYVTKPFSMTELLARIRAV
MRRIRPALTEDLVTFGDIVIDRAAHRVRRGDREVHLGPTEYRLLDHLIQHPGRVFSREQLLDTVWGSDVYVEARTVDVHV
GRLRKALNDKGEKDPIRTVRSAGYSLDEQFHE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
SH0031 YP_251946.1 hypothetical protein Not tested SCCmec Protein 5e-32 41
kdpE BAA82188.1 KDP operon transcriptional regulatory protein KdpE Not tested Type-II SCCmec Protein 1e-31 41
kdpE YP_039536.1 response regulator protein Not tested Type-II SCCmec Protein 2e-31 41
kdpE NP_370594.1 transcriptional regulator kdpE Not tested Type-II SCCmec Protein 2e-31 41
kdpE NP_373306.1 hypothetical protein Not tested Type-II SCCmec Protein 2e-31 41
kdeP YP_190033.1 DNA-binding response regulator KdeP Not tested Type-II SCCmec Protein 2e-31 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 7e-36 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Plav_0399 YP_001411679.1 two component transcriptional regulator HE999704.1.gene2815. Protein 2e-41 45
Plav_0399 YP_001411679.1 two component transcriptional regulator NC_012469.1.7686381. Protein 7e-41 43
Plav_0399 YP_001411679.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 2e-41 43
Plav_0399 YP_001411679.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 3e-41 43
Plav_0399 YP_001411679.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 3e-41 43
Plav_0399 YP_001411679.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 3e-41 43
Plav_0399 YP_001411679.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 3e-41 43
Plav_0399 YP_001411679.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 3e-41 43
Plav_0399 YP_001411679.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 3e-41 43
Plav_0399 YP_001411679.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 3e-41 43
Plav_0399 YP_001411679.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 3e-41 43
Plav_0399 YP_001411679.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 3e-41 43
Plav_0399 YP_001411679.1 two component transcriptional regulator NC_002758.1121390.p0 Protein 7e-37 42
Plav_0399 YP_001411679.1 two component transcriptional regulator NC_010079.5776364.p0 Protein 7e-37 42
Plav_0399 YP_001411679.1 two component transcriptional regulator NC_002952.2859858.p0 Protein 7e-37 42
Plav_0399 YP_001411679.1 two component transcriptional regulator NC_007622.3794948.p0 Protein 7e-37 42
Plav_0399 YP_001411679.1 two component transcriptional regulator NC_003923.1003417.p0 Protein 7e-37 42
Plav_0399 YP_001411679.1 two component transcriptional regulator NC_013450.8614146.p0 Protein 7e-37 42
Plav_0399 YP_001411679.1 two component transcriptional regulator NC_002951.3238224.p0 Protein 7e-37 42
Plav_0399 YP_001411679.1 two component transcriptional regulator NC_007793.3914065.p0 Protein 7e-37 42
Plav_0399 YP_001411679.1 two component transcriptional regulator AE016830.1.gene1681. Protein 5e-38 42
Plav_0399 YP_001411679.1 two component transcriptional regulator NC_008702.1.4607594. Protein 1e-34 42
Plav_0399 YP_001411679.1 two component transcriptional regulator NC_012469.1.7685629. Protein 2e-36 41
Plav_0399 YP_001411679.1 two component transcriptional regulator CP001918.1.gene3444. Protein 9e-35 41
Plav_0399 YP_001411679.1 two component transcriptional regulator CP000647.1.gene2531. Protein 1e-35 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Plav_0399 YP_001411679.1 two component transcriptional regulator VFG1390 Protein 2e-38 42
Plav_0399 YP_001411679.1 two component transcriptional regulator VFG1702 Protein 3e-36 41