Gene Information

Name : Fnod_1490 (Fnod_1490)
Accession : YP_001410990.1
Strain : Fervidobacterium nodosum Rt17-B1
Genome accession: NC_009718
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1618319 - 1619038 bp
Length : 720 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: tpt:Tpet_1136 two component transcriptional regulator, winged helix family

DNA sequence :
ATGGCAAAAAAAACGATTATGATTATTGATGACCAACCAGAGATTCTGGAATTGGTAAGTTTTACGTTACAGAAAGAAGG
ATACGACGTTATCCCTGCAGAAGATGCTGAGAAAGCTCTTCAAGAATTAAAAGAAAAAGATGTAGATATGTTTATAGTCG
ATATAATGCTTCCAAATATGGACGGCTTCGAATTTGTTAGGACAATAAGAGCTAAAGACAAACATAAGTTAACGCCTGTT
ATCTTCCTTAGTGCAAAAGGTGAAGAATTTGATAAGGTACTTGGGTTGGAACTTGGCGCAGATGATTACATAGTAAAACC
ATTCAGCGTTAGAGAGCTTCTTGCAAGAATTAGAGCCGTATTTAGAAGAATGCAACTTGGTACGGTTGTAAAAGAAGAAA
AACCGAAGAAAATTGTTGCAAAAGATTTGGAAATCGATATAGACAAATACGAAGTAAGAGTAAAGGGAAAGAAAGTAAGT
CTTACCCCACTTGAATTTGACCTCCTAAGATTCCTTGCCGAAAACGAAGGGAAAGTATTTTCAAGAGATGTTTTACTTGA
CAAACTGTGGGGGTATGACTACTTCGGCGATACAAGAACTGTTGACGTACACATAAGAAGACTCAGAACAAAAATTGAAG
ATGATCCATCAAATCCAAGATACGTTGTTACAGTCAGAGGAAAAGGTTATAAATTTAGAGACCCAGGAAAGGAAGAATAA

Protein sequence :
MAKKTIMIIDDQPEILELVSFTLQKEGYDVIPAEDAEKALQELKEKDVDMFIVDIMLPNMDGFEFVRTIRAKDKHKLTPV
IFLSAKGEEFDKVLGLELGADDYIVKPFSVRELLARIRAVFRRMQLGTVVKEEKPKKIVAKDLEIDIDKYEVRVKGKKVS
LTPLEFDLLRFLAENEGKVFSRDVLLDKLWGYDYFGDTRTVDVHIRRLRTKIEDDPSNPRYVVTVRGKGYKFRDPGKEE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 7e-41 45
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 5e-41 45

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Fnod_1490 YP_001410990.1 two component transcriptional regulator NC_012469.1.7685629. Protein 2e-50 49
Fnod_1490 YP_001410990.1 two component transcriptional regulator HE999704.1.gene2815. Protein 1e-47 47
Fnod_1490 YP_001410990.1 two component transcriptional regulator AE016830.1.gene1681. Protein 6e-52 45
Fnod_1490 YP_001410990.1 two component transcriptional regulator AF155139.2.orf0.gene Protein 3e-43 44
Fnod_1490 YP_001410990.1 two component transcriptional regulator AE000516.2.gene3505. Protein 1e-40 44
Fnod_1490 YP_001410990.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 1e-47 43
Fnod_1490 YP_001410990.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 2e-47 43
Fnod_1490 YP_001410990.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 1e-47 43
Fnod_1490 YP_001410990.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 2e-47 43
Fnod_1490 YP_001410990.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 2e-47 43
Fnod_1490 YP_001410990.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 2e-47 43
Fnod_1490 YP_001410990.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 2e-47 43
Fnod_1490 YP_001410990.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 2e-47 43
Fnod_1490 YP_001410990.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 2e-47 43
Fnod_1490 YP_001410990.1 two component transcriptional regulator NC_012469.1.7686381. Protein 4e-43 43
Fnod_1490 YP_001410990.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 2e-47 43
Fnod_1490 YP_001410990.1 two component transcriptional regulator NC_005054.2598277.p0 Protein 4e-41 43
Fnod_1490 YP_001410990.1 two component transcriptional regulator NC_014475.1.orf0.gen Protein 4e-41 43
Fnod_1490 YP_001410990.1 two component transcriptional regulator FJ349556.1.orf0.gene Protein 4e-42 42
Fnod_1490 YP_001410990.1 two component transcriptional regulator AE015929.1.gene1106. Protein 5e-31 41
Fnod_1490 YP_001410990.1 two component transcriptional regulator BAC0125 Protein 2e-32 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Fnod_1490 YP_001410990.1 two component transcriptional regulator VFG1563 Protein 4e-41 45
Fnod_1490 YP_001410990.1 two component transcriptional regulator VFG1702 Protein 2e-41 45
Fnod_1490 YP_001410990.1 two component transcriptional regulator VFG1389 Protein 2e-31 43