Gene Information

Name : bla (CKL_2902)
Accession : YP_001396285.1
Strain : Clostridium kluyveri DSM 555
Genome accession: NC_009706
Putative virulence/resistance : Resistance
Product : hypothetical protein
Function : -
COG functional category : V : Defense mechanisms
COG ID : COG2367
EC number : 3.5.2.6
Position : 2963152 - 2964084 bp
Length : 933 bp
Strand : -
Note : beta-lactamase, type I precursor

DNA sequence :
ATGCAAAAAATAGTAAATTTGAAATTGAAGGCAAATAAGCTTAAATTTGGTGTACTTATGATGCTTGTGATTTTTTTTCT
TACTAGTTGTGGAAAGACAGAATCTCAATCACATTTAAACACGAAGTCTGACATACAATATAATTCTGCATTTTCCCAAC
TTGAAAGTGATTATGGTGCTAAACTTGGAGTATATGCTTTTGACACAGAAACGAATAAAGAAGTTGCATATCGTGCTGAT
GATAGGTTCGCTTATTGTTCTACTTTCAAGGCGTTAGCTGCGGGTGCTGTTTTAAAACAAGATTCATTGGAACAGCTTAA
ACAATTAGTTAAATATAAAAAAGAAGATGTTCTTTCTTATGCTCCAATTGCAAAAGATAATGTTGATAAAGGCATGACCA
TTGAAGAAATTTGCAGTGCAGCAATACGTTTCAGCGATAATACAGCTGCAAATCTTTTGTTAAATCATATAGGTGGACCT
AAAGGTTTTAAATCAGCACTTAATCAATTGGGGGATAGCGTTACGCAACCTGTACATATAGAACCAGAACTAAATGAAGG
CATACCTGGAGATATTGGAGACACTAGTACACCAAGACAATTGGCAACTGATTTGCAAGCATACACAACTGGAAATATAT
TGACAGAGGACAAGAAAAAAATTCTTATCGATTGGATGGCAGGAAACACAACGGGTAATACACTAATTCGTGCAGGAGCA
CCAAAGAGCTGGATAGTTGCTGACAAAAGCGGAACTGGTCCTTATGGAAGAAGGAATGATATTGCTATAGTAATGCCACC
AAATAAAAAACCTATAATTATTGCAATATTGTCAACTCACGATACAAAAGAGGCTAAATATGATGACAAATTAATTGCTA
AAGCTTCTAAAATTATATTTGATTCTTTTACTACAACTGAAAATAAGGAGTAA

Protein sequence :
MQKIVNLKLKANKLKFGVLMMLVIFFLTSCGKTESQSHLNTKSDIQYNSAFSQLESDYGAKLGVYAFDTETNKEVAYRAD
DRFAYCSTFKALAAGAVLKQDSLEQLKQLVKYKKEDVLSYAPIAKDNVDKGMTIEEICSAAIRFSDNTAANLLLNHIGGP
KGFKSALNQLGDSVTQPVHIEPELNEGIPGDIGDTSTPRQLATDLQAYTTGNILTEDKKKILIDWMAGNTTGNTLIRAGA
PKSWIVADKSGTGPYGRRNDIAIVMPPNKKPIIIAILSTHDTKEAKYDDKLIAKASKIIFDSFTTTENKE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
blaCTX-M2 ACF06162.1 beta-lactamase CTX-M2 Not tested Tn5036-like Protein 5e-44 44
blaTEM-1b AGK07093.1 TEM-1b beta lactamase Not tested SGI1 Protein 5e-39 42
blaTEM AFV53104.1 TEM-1 beta-lactamase Not tested AbGRI2-1 Protein 5e-39 42
ABTW07_3874 YP_005797122.1 beta-lactamase TEM Not tested AbaR4e Protein 7e-39 42
blaTEM-1b ACK44542.1 BlaTEM-1b beta lactamase Not tested SGI1 Protein 5e-39 42
blaTEM-1b ACF06168.1 beta-lactamase TEM-1b Not tested Tn5036-like Protein 5e-39 42
blaTEM-1 ADI24150.1 beta-lactamase TEM-1 Not tested AbaR1 Protein 5e-39 42
blaTEM-1b AGK07035.1 TEM-1b beta lactamase Not tested SGI1 Protein 5e-39 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
bla YP_001396285.1 hypothetical protein AF367983.gene.p01 Protein 8e-74 55
bla YP_001396285.1 hypothetical protein DQ663489.gene.p01 Protein 3e-44 45
bla YP_001396285.1 hypothetical protein AY005110.1.gene1.p1 Protein 2e-43 45
bla YP_001396285.1 hypothetical protein DQ328639.gene.p01 Protein 3e-44 45
bla YP_001396285.1 hypothetical protein DQ408762.1.gene1.p1 Protein 3e-44 44
bla YP_001396285.1 hypothetical protein GU127598.1.gene1.p1 Protein 3e-44 44
bla YP_001396285.1 hypothetical protein U95364.1.gene1.p01 Protein 1e-43 44
bla YP_001396285.1 hypothetical protein GQ149244.1.gene1.p01 Protein 4e-44 44
bla YP_001396285.1 hypothetical protein HM776707.1.gene1.p1 Protein 3e-44 44
bla YP_001396285.1 hypothetical protein X92507.1.gene1.p01 Protein 3e-44 44
bla YP_001396285.1 hypothetical protein AJ416344.1.gene1.p01 Protein 7e-44 44
bla YP_001396285.1 hypothetical protein AJ567481.1.gene1.p01 Protein 5e-44 44
bla YP_001396285.1 hypothetical protein DQ125241.gene.p01 Protein 3e-44 44
bla YP_001396285.1 hypothetical protein EF374097.1.gene1.p01 Protein 3e-44 44
bla YP_001396285.1 hypothetical protein DQ102702.1.gene1.p1 Protein 4e-44 44
bla YP_001396285.1 hypothetical protein AY130284.1.gene1.p1 Protein 9e-40 44
bla YP_001396285.1 hypothetical protein AY130285.1.gene1.p1 Protein 9e-40 44
bla YP_001396285.1 hypothetical protein HM246246.1.gene1.p1 Protein 1e-39 44
bla YP_001396285.1 hypothetical protein AJ277415.1.gene1.p01 Protein 5e-39 44
bla YP_001396285.1 hypothetical protein JF949916.1.gene1.p01 Protein 6e-39 43
bla YP_001396285.1 hypothetical protein JF949915.1.gene1.p01 Protein 4e-39 43
bla YP_001396285.1 hypothetical protein AY130282.1.gene1.p1 Protein 5e-39 43
bla YP_001396285.1 hypothetical protein AY292654.1.gene1.p1 Protein 2e-45 43
bla YP_001396285.1 hypothetical protein AY649755.1.gene1.p01 Protein 1e-45 43
bla YP_001396285.1 hypothetical protein GQ149243.1.gene1.p01 Protein 2e-43 43
bla YP_001396285.1 hypothetical protein U50278.1.gene2.p01 Protein 3e-44 43
bla YP_001396285.1 hypothetical protein AY033516.1.gene2.p01 Protein 7e-44 43
bla YP_001396285.1 hypothetical protein X64523.1.gene1.p01 Protein 2e-38 43
bla YP_001396285.1 hypothetical protein AF203816.1.gene1.p01 Protein 1e-38 43
bla YP_001396285.1 hypothetical protein DQ072853.1.gene1.p01 Protein 2e-38 43
bla YP_001396285.1 hypothetical protein DQ834728.1.gene1.p1 Protein 4e-40 43
bla YP_001396285.1 hypothetical protein DQ679961.1.gene1.p01 Protein 1e-38 43
bla YP_001396285.1 hypothetical protein X65254.1.gene1.p01 Protein 1e-39 43
bla YP_001396285.1 hypothetical protein AY874537.1.gene1.p01 Protein 1e-39 43
bla YP_001396285.1 hypothetical protein X65253.1.gene1.p01 Protein 1e-38 43
bla YP_001396285.1 hypothetical protein AF427129.1.gene1.p01 Protein 2e-39 43
bla YP_001396285.1 hypothetical protein X57972.1.gene1.p1 Protein 8e-40 43
bla YP_001396285.1 hypothetical protein AY491682.1.gene1.p1 Protein 1e-39 43
bla YP_001396285.1 hypothetical protein AY574271.1.gene1.p01 Protein 4e-39 43
bla YP_001396285.1 hypothetical protein AM849805.1.gene1.p01 Protein 1e-38 43
bla YP_001396285.1 hypothetical protein AY307100.1.gene1.p1 Protein 3e-39 43
bla YP_001396285.1 hypothetical protein AM087454.1.gene1.p01 Protein 7e-39 43
bla YP_001396285.1 hypothetical protein Y17583.1.gene1.p01 Protein 2e-38 43
bla YP_001396285.1 hypothetical protein AF190693.1.gene1.p01 Protein 7e-40 43
bla YP_001396285.1 hypothetical protein AY589495.1.gene1.p01 Protein 9e-39 43
bla YP_001396285.1 hypothetical protein AY628175.1.gene1.p01 Protein 1e-39 43
bla YP_001396285.1 hypothetical protein DQ834729.1.gene1.p1 Protein 3e-40 43
bla YP_001396285.1 hypothetical protein DQ105529.2.gene1.p01 Protein 1e-38 43
bla YP_001396285.1 hypothetical protein U37195.1.gene1.p1 Protein 9e-40 43
bla YP_001396285.1 hypothetical protein JN211012.1.gene1.p01 Protein 1e-38 43
bla YP_001396285.1 hypothetical protein AJ746225.1.gene1.p01 Protein 1e-38 43
bla YP_001396285.1 hypothetical protein AF535127.1.gene1.p01 Protein 8e-40 43
bla YP_001396285.1 hypothetical protein AF427128.1.gene1.p01 Protein 1e-39 43
bla YP_001396285.1 hypothetical protein Y17584.1.gene1.p01 Protein 7e-40 43
bla YP_001396285.1 hypothetical protein AY072920.1.gene1.p1 Protein 4e-39 43
bla YP_001396285.1 hypothetical protein Y10279.1.gene1.p01 Protein 9e-39 43
bla YP_001396285.1 hypothetical protein Y10280.1.gene1.p01 Protein 1e-38 43
bla YP_001396285.1 hypothetical protein FJ360884.1.gene1.p01 Protein 2e-38 43
bla YP_001396285.1 hypothetical protein AY628176.1.gene1.p01 Protein 3e-39 43
bla YP_001396285.1 hypothetical protein AJ277414.1.gene1.p01 Protein 8e-39 43
bla YP_001396285.1 hypothetical protein Y10281.1.gene1.p01 Protein 1e-38 43
bla YP_001396285.1 hypothetical protein EU815939.1.gene1.p1 Protein 3e-39 43
bla YP_001396285.1 hypothetical protein AF468003.1.gene1.p1 Protein 1e-38 43
bla YP_001396285.1 hypothetical protein HQ529916.1.gene1.p01 Protein 1e-39 43
bla YP_001396285.1 hypothetical protein AJ239002.1.gene1.p01 Protein 1e-38 43
bla YP_001396285.1 hypothetical protein FJ919776.1.gene1.p01 Protein 3e-39 43
bla YP_001396285.1 hypothetical protein AY750914.gene.p01 Protein 4e-42 42
bla YP_001396285.1 hypothetical protein AB205197.1.gene1.p01 Protein 4e-42 42
bla YP_001396285.1 hypothetical protein X92506.gene.p01 Protein 4e-45 42
bla YP_001396285.1 hypothetical protein EF210159.1.gene1.p01 Protein 2e-44 42
bla YP_001396285.1 hypothetical protein AY143430.1.gene1.p01 Protein 5e-44 42
bla YP_001396285.1 hypothetical protein AJ005045.gene.p01 Protein 3e-41 42
bla YP_001396285.1 hypothetical protein AJ704396.1.gene1.p01 Protein 2e-45 42
bla YP_001396285.1 hypothetical protein HQ833651.1.gene1.p01 Protein 4e-44 42
bla YP_001396285.1 hypothetical protein AJ416345.gene.p01 Protein 8e-44 42
bla YP_001396285.1 hypothetical protein EU402393.1.gene1.p1 Protein 3e-45 42
bla YP_001396285.1 hypothetical protein AY847144.1.gene1.p01 Protein 3e-44 42
bla YP_001396285.1 hypothetical protein FJ214366.1.gene1.p1 Protein 5e-44 42
bla YP_001396285.1 hypothetical protein AM411407.1.gene1.p01 Protein 4e-45 42
bla YP_001396285.1 hypothetical protein HQ833652.1.gene1.p01 Protein 3e-44 42
bla YP_001396285.1 hypothetical protein AB284167.2.gene1.p01 Protein 1e-44 42
bla YP_001396285.1 hypothetical protein AF252622.2.gene2.p01 Protein 3e-44 42
bla YP_001396285.1 hypothetical protein AY847147.1.gene1.p01 Protein 4e-44 42
bla YP_001396285.1 hypothetical protein AY847145.1.gene1.p01 Protein 1e-43 42
bla YP_001396285.1 hypothetical protein AY157676.1.gene1.p01 Protein 1e-41 42
bla YP_001396285.1 hypothetical protein AY080894.1.gene1.p01 Protein 4e-45 42
bla YP_001396285.1 hypothetical protein EF581888.1.gene1.p01 Protein 2e-44 42
bla YP_001396285.1 hypothetical protein JF274247.1.gene1.p01 Protein 7e-44 42
bla YP_001396285.1 hypothetical protein HQ166709.1.gene1.p01 Protein 2e-43 42
bla YP_001396285.1 hypothetical protein AY267213.1.gene1.p01 Protein 2e-45 42
bla YP_001396285.1 hypothetical protein Y10278.1.gene1.p01 Protein 3e-45 42
bla YP_001396285.1 hypothetical protein AY847148.1.gene1.p01 Protein 8e-45 42
bla YP_001396285.1 hypothetical protein FJ214368.1.gene1.p1 Protein 9e-44 42
bla YP_001396285.1 hypothetical protein DQ885477.1.gene1.p01 Protein 4e-45 42
bla YP_001396285.1 hypothetical protein AF252623.2.gene1.p01 Protein 2e-44 42
bla YP_001396285.1 hypothetical protein FJ907381.1.gene1.p01 Protein 6e-44 42
bla YP_001396285.1 hypothetical protein FJ214369.1.gene1.p1 Protein 2e-43 42
bla YP_001396285.1 hypothetical protein GQ351346.1.gene1.p01 Protein 2e-45 42
bla YP_001396285.1 hypothetical protein AF305837.gene.p01 Protein 2e-45 42
bla YP_001396285.1 hypothetical protein EF426798.1.gene1.p1 Protein 6e-45 42
bla YP_001396285.1 hypothetical protein FJ815436.1.gene1.p01 Protein 4e-44 42
bla YP_001396285.1 hypothetical protein AF174129.3.gene9.p01 Protein 8e-44 42
bla YP_001396285.1 hypothetical protein AF189721.1.gene1.p01 Protein 3e-42 42
bla YP_001396285.1 hypothetical protein AJ549244.1.gene1.p01 Protein 3e-45 42
bla YP_001396285.1 hypothetical protein DQ223685.1.gene1.p01 Protein 2e-44 42
bla YP_001396285.1 hypothetical protein AY847146.1.gene1.p01 Protein 5e-44 42
bla YP_001396285.1 hypothetical protein JF274243.1.gene1.p01 Protein 2e-43 42
bla YP_001396285.1 hypothetical protein HQ398214.1.gene1.p01 Protein 5e-45 42
bla YP_001396285.1 hypothetical protein FJ214367.1.gene1.p1 Protein 3e-44 42
bla YP_001396285.1 hypothetical protein HQ913565.1.gene1.p01 Protein 4e-44 42
bla YP_001396285.1 hypothetical protein AJ557142.gene.p01 Protein 3e-45 42
bla YP_001396285.1 hypothetical protein DQ061159.1.gene1.p01 Protein 1e-44 42
bla YP_001396285.1 hypothetical protein AF325134.1.gene1.p1 Protein 1e-43 42
bla YP_001396285.1 hypothetical protein AY238472.1.gene1.p01 Protein 1e-45 42
bla YP_001396285.1 hypothetical protein AY156923.1.gene1.p01 Protein 2e-44 42
bla YP_001396285.1 hypothetical protein AY822595.1.gene1.p01 Protein 3e-44 42
bla YP_001396285.1 hypothetical protein AY847143.1.gene1.p01 Protein 7e-44 42
bla YP_001396285.1 hypothetical protein HM803271.1.gene1.p01 Protein 2e-43 42
bla YP_001396285.1 hypothetical protein AB177384.1.gene1.p01 Protein 2e-45 42
bla YP_001396285.1 hypothetical protein DQ256091.1.gene1.p1 Protein 3e-45 42
bla YP_001396285.1 hypothetical protein JN227085.1.gene1.p01 Protein 1e-44 42
bla YP_001396285.1 hypothetical protein AF325133.1.gene1.p1 Protein 3e-44 42
bla YP_001396285.1 hypothetical protein HM755448.1.gene1.p01 Protein 4e-44 42
bla YP_001396285.1 hypothetical protein EF418608.1.gene1.p01 Protein 9e-44 42
bla YP_001396285.1 hypothetical protein Y14156.1.gene1.p01 Protein 7e-42 42
bla YP_001396285.1 hypothetical protein DQ810789.1.gene1.p01 Protein 4e-45 42
bla YP_001396285.1 hypothetical protein HQ398215.1.gene1.p01 Protein 2e-44 42
bla YP_001396285.1 hypothetical protein AY029068.1.gene1.p1 Protein 7e-44 42
bla YP_001396285.1 hypothetical protein AY995206.gene.p01 Protein 2e-45 42
bla YP_001396285.1 hypothetical protein EF219142.1.gene1.p01 Protein 3e-45 42
bla YP_001396285.1 hypothetical protein JF966749.1.gene1.p01 Protein 7e-45 42
bla YP_001396285.1 hypothetical protein JF274246.1.gene1.p01 Protein 9e-44 42
bla YP_001396285.1 hypothetical protein FJ873739.1.gene1.p01 Protein 1e-45 42
bla YP_001396285.1 hypothetical protein JF274242.1.gene1.p01 Protein 2e-44 42
bla YP_001396285.1 hypothetical protein JN416112.1.gene1.p01 Protein 3e-39 42
bla YP_001396285.1 hypothetical protein DQ279850.1.gene1.p1 Protein 1e-39 42
bla YP_001396285.1 hypothetical protein HM066995.1.gene1.p01 Protein 5e-45 42
bla YP_001396285.1 hypothetical protein AY956335.1.gene1.p1 Protein 3e-39 42
bla YP_001396285.1 hypothetical protein EF468463.1.gene1.p01 Protein 7e-39 42
bla YP_001396285.1 hypothetical protein GQ140348.1.gene1.p01 Protein 2e-46 42
bla YP_001396285.1 hypothetical protein FJ873740.1.gene1.p01 Protein 3e-39 42
bla YP_001396285.1 hypothetical protein AY826417.1.gene1.p01 Protein 5e-39 42
bla YP_001396285.1 hypothetical protein FQ312006.1.gene118.p Protein 3e-39 42
bla YP_001396285.1 hypothetical protein AY528425.1.gene1.p1 Protein 6e-39 42
bla YP_001396285.1 hypothetical protein EU729727.1.gene1.p1 Protein 1e-46 42
bla YP_001396285.1 hypothetical protein HQ641421.1.gene1.p01 Protein 3e-45 42
bla YP_001396285.1 hypothetical protein EF136377.1.gene1.p01 Protein 2e-39 42
bla YP_001396285.1 hypothetical protein AM286274.1.gene1.p01 Protein 5e-39 42
bla YP_001396285.1 hypothetical protein EF534736.1.gene1.p01 Protein 8e-39 42
bla YP_001396285.1 hypothetical protein DQ075245.1.gene1.p01 Protein 1e-38 42
bla YP_001396285.1 hypothetical protein NC_011586.7045197.p0 Protein 3e-39 42
bla YP_001396285.1 hypothetical protein GU371926.1.gene94.p0 Protein 4e-39 42
bla YP_001396285.1 hypothetical protein X54606.1.gene1.p01 Protein 6e-39 42
bla YP_001396285.1 hypothetical protein Y14574.2.gene1.p01 Protein 3e-39 42
bla YP_001396285.1 hypothetical protein AF351241.1.gene1.p01 Protein 5e-39 42
bla YP_001396285.1 hypothetical protein DQ909059.1.gene1.p1 Protein 6e-39 42
bla YP_001396285.1 hypothetical protein FJ405211.1.gene1.p01 Protein 2e-39 42
bla YP_001396285.1 hypothetical protein AM941159.1.gene1.p01 Protein 5e-39 42
bla YP_001396285.1 hypothetical protein DQ286729.1.gene1.p1 Protein 3e-39 42
bla YP_001396285.1 hypothetical protein AY034847.1.gene1.p01 Protein 2e-45 42
bla YP_001396285.1 hypothetical protein HQ451074.1.gene4.p01 Protein 3e-39 42
bla YP_001396285.1 hypothetical protein EU274580.1.gene1.p1 Protein 4e-39 42
bla YP_001396285.1 hypothetical protein GU550123.1.gene1.p1 Protein 7e-39 42
bla YP_001396285.1 hypothetical protein AF395881.gene.p01 Protein 2e-46 42
bla YP_001396285.1 hypothetical protein AY092401.1.gene1.p1 Protein 2e-39 42
bla YP_001396285.1 hypothetical protein AF397068.1.gene1.p1 Protein 3e-39 42
bla YP_001396285.1 hypothetical protein FJ807656.1.gene1.p01 Protein 8e-39 42
bla YP_001396285.1 hypothetical protein AF397067.1.gene1.p1 Protein 1e-39 42
bla YP_001396285.1 hypothetical protein AF297554.1.gene1.p1 Protein 4e-45 42
bla YP_001396285.1 hypothetical protein NC_010558.1.6276043. Protein 3e-39 42
bla YP_001396285.1 hypothetical protein AF188199.1.gene1.p01 Protein 6e-39 42
bla YP_001396285.1 hypothetical protein FJ234412.1.gene1.p01 Protein 1e-46 42
bla YP_001396285.1 hypothetical protein FJ197316.1.gene1.p1 Protein 2e-39 42
bla YP_001396285.1 hypothetical protein AF427130.1.gene1.p01 Protein 3e-39 42
bla YP_001396285.1 hypothetical protein AJ866988.1.gene1.p01 Protein 8e-39 42
bla YP_001396285.1 hypothetical protein EU555534.1.gene1.p01 Protein 1e-45 42
bla YP_001396285.1 hypothetical protein AM183304.1.gene1.p01 Protein 3e-39 42
bla YP_001396285.1 hypothetical protein AF104441.1.gene1.p01 Protein 6e-39 42
bla YP_001396285.1 hypothetical protein AM049399.1.gene1.p01 Protein 2e-38 42
bla YP_001396285.1 hypothetical protein AY368236.1.gene1.p1 Protein 2e-39 42
bla YP_001396285.1 hypothetical protein JN254627.1.gene1.p01 Protein 5e-39 42
bla YP_001396285.1 hypothetical protein AF093512.1.gene1.p01 Protein 8e-39 42
bla YP_001396285.1 hypothetical protein AF255298.1.gene1.p1 Protein 2e-45 41
bla YP_001396285.1 hypothetical protein EU202673.2.gene1.p2 Protein 2e-45 41
bla YP_001396285.1 hypothetical protein EU177100.1.gene1.p01 Protein 1e-45 41
bla YP_001396285.1 hypothetical protein AY515297.1.gene1.p1 Protein 4e-44 41
bla YP_001396285.1 hypothetical protein DQ268764.2.gene6.p01 Protein 1e-45 41
bla YP_001396285.1 hypothetical protein AY598759.gene.p01 Protein 2e-45 41
bla YP_001396285.1 hypothetical protein DQ211987.1.gene1.p01 Protein 2e-43 41
bla YP_001396285.1 hypothetical protein EU545409.1.gene1.p1 Protein 8e-43 41
bla YP_001396285.1 hypothetical protein DQ023162.1.gene1.p1 Protein 8e-41 41
bla YP_001396285.1 hypothetical protein GQ870432.1.gene1.p1 Protein 7e-41 41
bla YP_001396285.1 hypothetical protein AY954516.1.gene1.p1 Protein 4e-41 41
bla YP_001396285.1 hypothetical protein AF488377.1.gene1.p1 Protein 3e-44 41
bla YP_001396285.1 hypothetical protein AM982522.2.gene1.p01 Protein 2e-41 41
bla YP_001396285.1 hypothetical protein EU136031.3.gene1.p3 Protein 3e-43 41
bla YP_001396285.1 hypothetical protein HM167760.1.gene1.p01 Protein 1e-41 41
bla YP_001396285.1 hypothetical protein FJ971899.1.gene1.p1 Protein 7e-41 41
bla YP_001396285.1 hypothetical protein AF518567.2.gene4.p01 Protein 6e-41 41
bla YP_001396285.1 hypothetical protein AF275256.gene.p01 Protein 2e-41 41
bla YP_001396285.1 hypothetical protein AY039040.1.gene1.p01 Protein 2e-38 41
bla YP_001396285.1 hypothetical protein AY368237.1.gene1.p1 Protein 3e-39 41
bla YP_001396285.1 hypothetical protein AY243512.1.gene1.p01 Protein 8e-39 41
bla YP_001396285.1 hypothetical protein JN227084.1.gene1.p01 Protein 4e-39 41
bla YP_001396285.1 hypothetical protein AF495873.1.gene1.p1 Protein 2e-38 41
bla YP_001396285.1 hypothetical protein AF347054.1.gene1.p1 Protein 6e-39 41
bla YP_001396285.1 hypothetical protein AY589493.1.gene1.p01 Protein 1e-38 41
bla YP_001396285.1 hypothetical protein DQ105528.2.gene1.p01 Protein 1e-38 41
bla YP_001396285.1 hypothetical protein AY853593.1.gene1.p1 Protein 2e-38 41
bla YP_001396285.1 hypothetical protein AF516720.1.gene1.p1 Protein 4e-39 41
bla YP_001396285.1 hypothetical protein AF397066.1.gene1.p1 Protein 2e-38 41
bla YP_001396285.1 hypothetical protein AF427127.1.gene1.p01 Protein 5e-39 41
bla YP_001396285.1 hypothetical protein Y17582.1.gene1.p01 Protein 3e-38 41
bla YP_001396285.1 hypothetical protein AF190694.1.gene1.p01 Protein 4e-39 41
bla YP_001396285.1 hypothetical protein AJ308558.1.gene1.p01 Protein 1e-38 41
bla YP_001396285.1 hypothetical protein AF190695.1.gene1.p01 Protein 2e-38 41
bla YP_001396285.1 hypothetical protein AY327539.1.gene1.p01 Protein 3e-38 41