Gene Information

Name : CLI_0819 (CLI_0819)
Accession : YP_001390091.1
Strain : Clostridium botulinum Langeland
Genome accession: NC_009699
Putative virulence/resistance : Resistance
Product : mercuric transport periplasmic protein
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG2217
EC number : -
Position : 854549 - 854788 bp
Length : 240 bp
Strand : +
Note : identified by match to protein family HMM PF00403

DNA sequence :
ATGCTTTTTAATAAGAAATCCGCAGGAAAAGAAATAGAATTAAAAGTAGAAGGAATGATGTGCAATCATTGCGAAATTGC
AGTTAAAGAAGCTCTTCAAAAAGTAGATGGAGTGAAAAAAGTAAAGGTGAGCCATTTTAAGAAAAGAGCCTTTATTACAT
TAGAAGAGGGAAAAGATGTTGAAGTTTTTGAATTAATACATGCTGTAAAATCTACGGGTTATGATGCTTCTGAAATATAA

Protein sequence :
MLFNKKSAGKEIELKVEGMMCNHCEIAVKEALQKVDGVKKVKVSHFKKRAFITLEEGKDVEVFELIHAVKSTGYDASEI

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merP AET25399.1 MerP Not tested PAGI-2(C) Protein 3e-07 43
merP AFG30122.1 MerP Not tested PAGI-2 Protein 3e-07 43
merP AGK07023.1 MerP Not tested SGI1 Protein 3e-07 43
merP AGK07081.1 MerP Not tested SGI1 Protein 3e-07 43
merP CAJ77062.1 Periplasmic mercuric ion binding protein Not tested AbaR1 Protein 5e-08 43
merP YP_006098389.1 mercuric ion transport protein Not tested Tn2411 Protein 4e-07 43
merP ACN81007.1 MerP periplasmic mercuric ion binding protein Not tested AbaR5 Protein 7e-08 43
merP ABQ57373.1 MerP Not tested SGI1 Protein 3e-07 43
merP AAN62179.1 periplasmic mercuric ion binding protein MerP Not tested PAGI-2(C) Protein 2e-07 43
unnamed ABR13399.1 copper-transporting ATPase 2 Not tested PAGI-5 Protein 4e-08 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CLI_0819 YP_001390091.1 mercuric transport periplasmic protein BAC0085 Protein 0.005 41