Gene Information

Name : CLC_0786 (CLC_0786)
Accession : YP_001386665.1
Strain : Clostridium botulinum Hall
Genome accession: NC_009698
Putative virulence/resistance : Resistance
Product : heavy metal binding protein
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG2217
EC number : -
Position : 813445 - 813684 bp
Length : 240 bp
Strand : +
Note : identified by match to protein family HMM PF00403

DNA sequence : 
ATGTTTTTTAGTAAAAAATCCTCAGGAAAAGAAATAGAATTAAAAGTAGAAGGAATGATGTGCAATCATTGCGAAATTGC
AGTTAAAGAAGCTCTTCAAAAAGTAGATGGAGTGAAAAAAGTAAAGGTGAGCCATTTTAAGAAAAGAGCCTTTATTACAT
TAGAAGAGGGAAAAGATGTTGAAGTTTTCGAATTAATGCATGCTGTAAAAGCTACGGGTTATGATGCTTCTGAAATATAA

Protein sequence : 
MFFSKKSSGKEIELKVEGMMCNHCEIAVKEALQKVDGVKKVKVSHFKKRAFITLEEGKDVEVFELMHAVKATGYDASEI

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merP AGK07023.1 MerP Not tested SGI1 Protein 3e-07 43
merP AGK07081.1 MerP Not tested SGI1 Protein 3e-07 43
merP CAJ77062.1 Periplasmic mercuric ion binding protein Not tested AbaR1 Protein 6e-08 43
merP YP_006098389.1 mercuric ion transport protein Not tested Tn2411 Protein 4e-07 43
merP ACN81007.1 MerP periplasmic mercuric ion binding protein Not tested AbaR5 Protein 9e-08 43
merP ABQ57373.1 MerP Not tested SGI1 Protein 3e-07 43
merP AET25399.1 MerP Not tested PAGI-2(C) Protein 3e-07 43
merP AFG30122.1 MerP Not tested PAGI-2 Protein 3e-07 43
merP AAN62179.1 periplasmic mercuric ion binding protein MerP Not tested PAGI-2(C) Protein 3e-07 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
CLC_0786 YP_001386665.1 heavy metal binding protein BAC0085 Protein 0.010 41