Name : CLC_0786 (CLC_0786) Accession : YP_001386665.1 Strain : Clostridium botulinum Hall Genome accession: NC_009698 Putative virulence/resistance : Resistance Product : heavy metal binding protein Function : - COG functional category : P : Inorganic ion transport and metabolism COG ID : COG2217 EC number : - Position : 813445 - 813684 bp Length : 240 bp Strand : + Note : identified by match to protein family HMM PF00403 DNA sequence : ATGTTTTTTAGTAAAAAATCCTCAGGAAAAGAAATAGAATTAAAAGTAGAAGGAATGATGTGCAATCATTGCGAAATTGC AGTTAAAGAAGCTCTTCAAAAAGTAGATGGAGTGAAAAAAGTAAAGGTGAGCCATTTTAAGAAAAGAGCCTTTATTACAT TAGAAGAGGGAAAAGATGTTGAAGTTTTCGAATTAATGCATGCTGTAAAAGCTACGGGTTATGATGCTTCTGAAATATAA Protein sequence : MFFSKKSSGKEIELKVEGMMCNHCEIAVKEALQKVDGVKKVKVSHFKKRAFITLEEGKDVEVFELMHAVKATGYDASEI |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
merP | AGK07023.1 | MerP | Not tested | SGI1 | Protein | 3e-07 | 43 |
merP | AGK07081.1 | MerP | Not tested | SGI1 | Protein | 3e-07 | 43 |
merP | CAJ77062.1 | Periplasmic mercuric ion binding protein | Not tested | AbaR1 | Protein | 6e-08 | 43 |
merP | YP_006098389.1 | mercuric ion transport protein | Not tested | Tn2411 | Protein | 4e-07 | 43 |
merP | ACN81007.1 | MerP periplasmic mercuric ion binding protein | Not tested | AbaR5 | Protein | 9e-08 | 43 |
merP | ABQ57373.1 | MerP | Not tested | SGI1 | Protein | 3e-07 | 43 |
merP | AET25399.1 | MerP | Not tested | PAGI-2(C) | Protein | 3e-07 | 43 |
merP | AFG30122.1 | MerP | Not tested | PAGI-2 | Protein | 3e-07 | 43 |
merP | AAN62179.1 | periplasmic mercuric ion binding protein MerP | Not tested | PAGI-2(C) | Protein | 3e-07 | 43 |
Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
CLC_0786 | YP_001386665.1 | heavy metal binding protein | BAC0085 | Protein | 0.010 | 41 |