Gene Information

Name : Anae109_3677 (Anae109_3677)
Accession : YP_001380841.1
Strain : Anaeromyxobacter sp. Fw109-5
Genome accession: NC_009675
Putative virulence/resistance : Unknown
Product : IS66 Orf2 family protein
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG3436
EC number : -
Position : 4287691 - 4288086 bp
Length : 396 bp
Strand : +
Note : PFAM: IS66 Orf2 family protein; KEGG: mxa:MXAN_4117 transposase orf1, IS66 family

DNA sequence :
GTGATCACCATCCCGCGGTCGGTCCGCATCTTCATCGGGAAGAACCCGATAGACATGCGGAAGTCCATCGACGGCCTGAT
GAGCGTGGTCCAGGAGGAGCTCCGCCAGGACGCCTACTCGGGCCATCTCTTCGTGTTCCTGTCGAGGCGCGCGGACCGCG
TGAAGATCCTCGCCTGGGACAAGGGCGGCTTCGTCCTTCTCTACAAGCGACTCGAGCGCGGGCAGTTCAAACTGCCGCAC
ATCGGGCAGGACACGATGGCCGTCGAGATCGACTCGACACAGCTCGCGATGCTGCTCGACGGGATCGAGTTCGGCCGCGT
TCGTCGGCCCGCGCACTGGGAGCCGCCGTCCCAGGCGGATCGTCCCGCCTGCCGTCCCATGGACAAGCCGATCTGA

Protein sequence :
MITIPRSVRIFIGKNPIDMRKSIDGLMSVVQEELRQDAYSGHLFVFLSRRADRVKILAWDKGGFVLLYKRLERGQFKLPH
IGQDTMAVEIDSTQLAMLLDGIEFGRVRRPAHWEPPSQADRPACRPMDKPI

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
Z1599 NP_287103.1 hypothetical protein Not tested TAI Protein 8e-16 46
ECO103_3567 YP_003223430.1 hypothetical protein Not tested LEE Protein 3e-15 46
Z4338 NP_289563.1 hypothetical protein Not tested OI-122 Protein 3e-15 46
Z1160 NP_286695.1 hypothetical protein Not tested TAI Protein 8e-16 46
ECUMN_3364 YP_002414037.1 putative transposase ORF2, IS66 family Not tested Not named Protein 2e-15 44
ECO103_3553 YP_003223420.1 hypothetical protein Not tested LEE Protein 6e-17 42
Z4316 NP_289542.1 hypothetical protein Not tested OI-122 Protein 6e-17 42
unnamed AAL08461.1 unknown Not tested SRL Protein 3e-15 42
aec52 AAW51735.1 Aec52 Not tested AGI-3 Protein 6e-18 41
unnamed ADD91739.1 hypothetical protein Not tested PAI-I AL862 Protein 6e-18 41
Z5097 NP_290248.1 prophage-associated protein Not tested LEE Protein 5e-15 41
ECs4546 NP_312573.1 hypothetical protein Not tested LEE Protein 5e-15 41
c3561 NP_755436.1 hypothetical protein Not tested PAI I CFT073 Protein 4e-15 41
unnamed AAC31493.1 L0014 Not tested LEE Protein 4e-15 41
ECUMN_3327 YP_002414007.1 putative transposase ORF2, IS66 family Not tested Not named Protein 4e-15 41
Z1132 NP_286667.1 hypothetical protein Not tested TAI Protein 3e-14 41
hp4 AAC61716.1 Hp4 Not tested PAI I CFT073 Protein 4e-15 41
unnamed AAL99258.1 unknown Not tested LEE Protein 4e-15 41
Z1571 NP_287075.1 hypothetical protein Not tested TAI Protein 3e-14 41
unnamed ACU09438.1 IS66 family element orf2 Not tested LEE Protein 4e-15 41
c3578 NP_755453.1 hypothetical protein Not tested PAI I CFT073 Protein 5e-15 41
Z4336 NP_289561.1 hypothetical protein Not tested OI-122 Protein 5e-15 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Anae109_3677 YP_001380841.1 IS66 Orf2 family protein VFG1737 Protein 5e-16 44
Anae109_3677 YP_001380841.1 IS66 Orf2 family protein VFG1052 Protein 1e-15 42
Anae109_3677 YP_001380841.1 IS66 Orf2 family protein VFG0792 Protein 2e-15 41
Anae109_3677 YP_001380841.1 IS66 Orf2 family protein VFG1698 Protein 1e-15 41
Anae109_3677 YP_001380841.1 IS66 Orf2 family protein VFG1709 Protein 2e-15 41