Gene Information

Name : Bcer98_0386 (Bcer98_0386)
Accession : YP_001373738.1
Strain : Bacillus cytotoxicus NVH 391-98
Genome accession: NC_009674
Putative virulence/resistance : Resistance
Product : stress protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 443740 - 444318 bp
Length : 579 bp
Strand : +
Note : PFAM: stress protein; KEGG: bcz:BCZK0375 probable tellurium resistance protein, TerD family

DNA sequence :
ATGGCGATCCAGTTGCAAAAGGGACAGAAAATCGATTTGAGTAAGACAAGCCCTGGTCTAAAAAAAGCAATAATCGGCCT
TGGGTGGGATATTAAGGCGTATGATGGTGGATCTGATTATGATTTAGATGCATCAGCCTTTTTACTAGATGCACATGGAA
AATGTACGAAAGAAACAGATTTTATTTTCTATAACAACTTGCAGTCTCCTTGTGGATCTGTTTTACATACAGGTGACAAC
CGTACAGGTGAAGGAGAAGGCGATGATGAGCAACTTATTGTAGACTTAACAAAAGTTCCAGCGGATGTTCAAAAAATAGC
TTTTACAGTTACAATTTATGATGCGGAAAGTCGGAATCAAAACTTTGGACAAGTCGCAAATGCGTTTGTTCGTTTAGTAA
ATGAAGAAACAAATGAAGAAATTTTACGTTTTGATTTAGGAGAAGATTTTTCCATTGAAACAGCAGTTGTTTTTTGTGAA
TTATATCGTCATAATGGACAATGGAAGTTTAATGCGGTAGGAAGTGGATTCCAAGGGGGATTAGGTGCGCTTGTAAGAGC
GTATGGCTTGGATGCATAA

Protein sequence :
MAIQLQKGQKIDLSKTSPGLKKAIIGLGWDIKAYDGGSDYDLDASAFLLDAHGKCTKETDFIFYNNLQSPCGSVLHTGDN
RTGEGEGDDEQLIVDLTKVPADVQKIAFTVTIYDAESRNQNFGQVANAFVRLVNEETNEEILRFDLGEDFSIETAVVFCE
LYRHNGQWKFNAVGSGFQGGLGALVRAYGLDA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 3e-57 64
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-54 58
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-54 58
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 4e-54 57
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 3e-50 56
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-50 56
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-50 56
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 9e-48 55
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 3e-27 44
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-25 41
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 4e-25 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Bcer98_0386 YP_001373738.1 stress protein BAC0389 Protein 1e-54 59
Bcer98_0386 YP_001373738.1 stress protein BAC0390 Protein 5e-53 56
Bcer98_0386 YP_001373738.1 stress protein BAC0392 Protein 8e-26 41