Gene Information

Name : Oant_3209 (Oant_3209)
Accession : YP_001371746.1
Strain :
Genome accession: NC_009668
Putative virulence/resistance : Resistance
Product : MerR family transcriptional regulator
Function : -
COG functional category : K : Transcription
COG ID : COG0789
EC number : -
Position : 531374 - 531790 bp
Length : 417 bp
Strand : +
Note : PFAM: regulatory protein MerR; Transcription regulator MerR DNA binding; KEGG: net:Neut_0085 transcriptional regulator, MerR family protein

DNA sequence :
ATGAACGACAGAATTCTGATGATCGGCCAATTGGCTAGACGAACGGGGACCAAGGTCGAGACGATCCGGTTCTACGAGAA
GAACGGTCTCCTGCCCGCACCCTCGCGTACCGATGGCAACTACCGTGCATATGAGCCGGGCCACCTCAACCGCCTCAGCT
TCATCAGGCGTGCGCGCGAGCTTGGTTTCTCGCTCGATCAGATCAGGGAGTTTCTCAAGCTGGCCGACGATCGTTCGCAG
TCCTGCGCGGCGATTGATGCGATTGCAAAGGAGCACCGGAAGGAAGTCGAGCGAAAAATCGAAGACCTAACTGCGCTCAA
GTCGGAACTGGACAGGATGATAGACCAGTGTGGATGCGGGCTGGTCGCAGATTGTAGGATAATAGAGAGCCTGTCTCCGC
TGCCAGCCAGAACCTAA

Protein sequence :
MNDRILMIGQLARRTGTKVETIRFYEKNGLLPAPSRTDGNYRAYEPGHLNRLSFIRRARELGFSLDQIREFLKLADDRSQ
SCAAIDAIAKEHRKEVERKIEDLTALKSELDRMIDQCGCGLVADCRIIESLSPLPART

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
cadR ADZ05769.1 MerR family transcriptional regulator Not tested AbaR11 Protein 1e-22 42
ACICU_00234 YP_001844893.1 transcriptional regulator Not tested AbaR20 Protein 2e-22 42
cadR ACS32041.1 MerR family transcriptional regulator Not tested AbaR5 Protein 2e-22 42
cadR ACN81029.1 MerR family transcriptional regulator Not tested AbaR5 Protein 2e-22 42
pbrR CAJ77094.1 Transcriptional regulator Not tested AbaR1 Protein 1e-22 42
cadR AGK36653.1 MerR family transcriptional regulator Not tested AbaR26 Protein 1e-22 42
pbrR CAJ77021.1 transcription regulator Not tested AbaR1 Protein 1e-22 42
EXB37 ABD94723.1 putative regulator of mercury resistance conferring proteins Not tested ExoU island B Protein 2e-23 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Oant_3209 YP_001371746.1 MerR family transcriptional regulator BAC0058 Protein 3e-26 43
Oant_3209 YP_001371746.1 MerR family transcriptional regulator BAC0301 Protein 4e-22 42