Gene Information

Name : Oant_0766 (Oant_0766)
Accession : YP_001369317.1
Strain :
Genome accession: NC_009667
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 795892 - 796578 bp
Length : 687 bp
Strand : -
Note : TIGRFAM: phosphate regulon transcriptional regulatory protein PhoB; PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: bmb:BruAb1_2118 PhoB, phosphate regulon transcriptional regulatory protein Phob

DNA sequence :
ATGTCACAGGCACCCAAAATCGCTGTGGTAGAAGACGAAGAGGCGCTGAGCGTTCTTCTTCGCTATAATCTTGAGGCAGA
GGGCTACCAGGTCGATACAATGCTGCGCGGCGACGAAGCCGAGATCGCCTTGCGCGAGAACGTACCGGATCTGCTCATTC
TGGACTGGATGTTGCCGGGCGTATCGGGCATTGAGCTTTGCCGTCGCTTGCGCCAATGGCCGGAAACCGAACGCCTGCCC
ATCATCATGCTGACGGCACGTGGCGAGGAAAGCGAACGTGTTCGCGGCCTGAGCGTCGGTGCGGACGACTATGTCGTGAA
GCCATTTTCGACGCCGGAACTGCTGGCGCGCGTCAAGGCGATGTTGCGCCGGTCGAATCCGAGCATTCTTTCGCACGTGC
TGAAAGTGGGCGACCTGGTTCTCGACCGCCAACAGCATCGTGTCTATCGCAAGGAAAAGGAAGTTCGTCTCGGACCAACG
GAATTCCGCCTGCTCGAATATTTCATGATGTCGCCCGGTCGTGTCTTCTCACGTAGCCAGCTTCTGGATGGCGTTTGGGG
ACCGGACATCTATGTCGACGACCGCACGGTGGACGTCCATGTCGGACGGCTGCGCAAGGCGATCAATGTCGGTCGTGCGC
TCGATCCGATCCGCACCGTTCGGGGTGCGGGTTATTCTTTCGGGTGA

Protein sequence :
MSQAPKIAVVEDEEALSVLLRYNLEAEGYQVDTMLRGDEAEIALRENVPDLLILDWMLPGVSGIELCRRLRQWPETERLP
IIMLTARGEESERVRGLSVGADDYVVKPFSTPELLARVKAMLRRSNPSILSHVLKVGDLVLDRQQHRVYRKEKEVRLGPT
EFRLLEYFMMSPGRVFSRSQLLDGVWGPDIYVDDRTVDVHVGRLRKAINVGRALDPIRTVRGAGYSFG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 2e-34 44
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 3e-34 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Oant_0766 YP_001369317.1 two component transcriptional regulator NC_011595.7057856.p0 Protein 3e-36 43
Oant_0766 YP_001369317.1 two component transcriptional regulator NC_010400.5986590.p0 Protein 1e-35 43
Oant_0766 YP_001369317.1 two component transcriptional regulator NC_010410.6002989.p0 Protein 3e-36 43
Oant_0766 YP_001369317.1 two component transcriptional regulator HE999704.1.gene2815. Protein 7e-37 43
Oant_0766 YP_001369317.1 two component transcriptional regulator AE016830.1.gene1681. Protein 2e-35 42
Oant_0766 YP_001369317.1 two component transcriptional regulator AE000516.2.gene3505. Protein 5e-31 42
Oant_0766 YP_001369317.1 two component transcriptional regulator NC_012469.1.7686381. Protein 1e-35 41
Oant_0766 YP_001369317.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 1e-38 41
Oant_0766 YP_001369317.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 2e-38 41
Oant_0766 YP_001369317.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 2e-38 41
Oant_0766 YP_001369317.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 2e-38 41
Oant_0766 YP_001369317.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 2e-38 41
Oant_0766 YP_001369317.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 2e-38 41
Oant_0766 YP_001369317.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 1e-38 41
Oant_0766 YP_001369317.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 2e-38 41
Oant_0766 YP_001369317.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 2e-38 41
Oant_0766 YP_001369317.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 2e-38 41
Oant_0766 YP_001369317.1 two component transcriptional regulator NC_012469.1.7685629. Protein 9e-33 41
Oant_0766 YP_001369317.1 two component transcriptional regulator CP001918.1.gene3444. Protein 4e-34 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Oant_0766 YP_001369317.1 two component transcriptional regulator VFG1563 Protein 1e-34 44
Oant_0766 YP_001369317.1 two component transcriptional regulator VFG1702 Protein 1e-34 44
Oant_0766 YP_001369317.1 two component transcriptional regulator VFG1390 Protein 8e-34 42