Gene Information

Name : Shew185_0604 (Shew185_0604)
Accession : YP_001364828.1
Strain : Shewanella baltica OS185
Genome accession: NC_009665
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 722296 - 722979 bp
Length : 684 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: ava:Ava_3453 two component transcriptional regulator, winged helix family

DNA sequence :
ATGAACGTATTGCTTGTCGAAGATGAACAAAAAATTGCAGATTTTATCTGTGAAGGTTTGCGTGCCAAACATTTCAACGT
CACTCATTGTGCCGATGGCAATCAAGGTTATCAGGCGGCAAGTAATAATACTCATGATGTGATTATTCTCGACATTATGC
TACCGGGCAGAGATGGTTTGGATATTCTTCGTTCGCTGCGTCAACAAGGTGTCGATACGCCCATTATTCTGCTTACGGCA
CGTAATGAATTGGGTGATCGCGTTCAAGGGTTAGACATGGGCGCTGATGATTACTTAGCAAAACCGTTTTATGTTGAAGA
GTTGCATGCTCGGATTCAAGCCTTGCTTCGACGGCATGGCGGCACACAACAGCATGTCGTTGAGGTAGGCGCGTTGCAAC
TTGATTGTATTAATCGAAGCATTAATTGTCAGGGTCAATCAGTCGAACTCACTAGCCGAGAATTTAGCTTGCTTGAACAC
TTAATGCGTTCACCTAACCAAGTATTAACCCGGGGGCAGTTGTTGGAGCATGTTTGGGGATACGACTTTGATCCTTGTAC
CAATGTTGTTGATGTGTGCATTAAACGCATCCGCAGTAAAATGGCTTCATTAGAGAAGGCCGGAAAAATGGTCGGCGCCA
TTGAGTCGATCCGCGGCACAGGTTATCGCCTGAGCATTCGATAA

Protein sequence :
MNVLLVEDEQKIADFICEGLRAKHFNVTHCADGNQGYQAASNNTHDVIILDIMLPGRDGLDILRSLRQQGVDTPIILLTA
RNELGDRVQGLDMGADDYLAKPFYVEELHARIQALLRRHGGTQQHVVEVGALQLDCINRSINCQGQSVELTSREFSLLEH
LMRSPNQVLTRGQLLEHVWGYDFDPCTNVVDVCIKRIRSKMASLEKAGKMVGAIESIRGTGYRLSIR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 5e-37 41
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-36 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Shew185_0604 YP_001364828.1 two component transcriptional regulator NC_007622.3794948.p0 Protein 1e-38 44
Shew185_0604 YP_001364828.1 two component transcriptional regulator NC_003923.1003417.p0 Protein 1e-38 44
Shew185_0604 YP_001364828.1 two component transcriptional regulator NC_013450.8614146.p0 Protein 1e-38 44
Shew185_0604 YP_001364828.1 two component transcriptional regulator NC_002951.3238224.p0 Protein 1e-38 44
Shew185_0604 YP_001364828.1 two component transcriptional regulator NC_007793.3914065.p0 Protein 1e-38 44
Shew185_0604 YP_001364828.1 two component transcriptional regulator NC_002758.1121390.p0 Protein 1e-38 44
Shew185_0604 YP_001364828.1 two component transcriptional regulator NC_010079.5776364.p0 Protein 1e-38 44
Shew185_0604 YP_001364828.1 two component transcriptional regulator NC_002952.2859858.p0 Protein 1e-38 44
Shew185_0604 YP_001364828.1 two component transcriptional regulator AE015929.1.gene1106. Protein 6e-34 43
Shew185_0604 YP_001364828.1 two component transcriptional regulator BAC0125 Protein 3e-40 42
Shew185_0604 YP_001364828.1 two component transcriptional regulator BAC0197 Protein 3e-42 42
Shew185_0604 YP_001364828.1 two component transcriptional regulator BAC0083 Protein 1e-43 42
Shew185_0604 YP_001364828.1 two component transcriptional regulator HE999704.1.gene1528. Protein 3e-30 42
Shew185_0604 YP_001364828.1 two component transcriptional regulator BAC0347 Protein 2e-40 41
Shew185_0604 YP_001364828.1 two component transcriptional regulator BAC0111 Protein 4e-43 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Shew185_0604 YP_001364828.1 two component transcriptional regulator VFG1389 Protein 1e-38 43
Shew185_0604 YP_001364828.1 two component transcriptional regulator VFG0596 Protein 2e-37 41