Gene Information

Name : Krad_2802 (Krad_2802)
Accession : YP_001362536.1
Strain : Kineococcus radiotolerans SRS30216
Genome accession: NC_009664
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 4197437 - 4198099 bp
Length : 663 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: sco:SCO2143 two component system response regulator

DNA sequence : 
GTGACCAGCATCCTCATCGCCGAGGACGAGACCCGGATCGCCGCGTTCGTGGAGAAGGGGTTGCGCGCCAACGGGTACGC
CACCACCATCGCCACCGACGGCCGGACCGCGCACGACCTGGCCGGCACCGGCCTGTTCGACCTGCTGATCCTGGACATCG
GGCTGCCGGTGGTGGACGGCTTCACCGTCCTGCGCCGGCTGCGGGCGGAGCGGCACGCGCTGCCCGTCATCATCCTCACC
GCCCGCGACGCCGTCGCCGACACCGTCGCCGGCCTGGACGGCGGGGCCGACGACTACGTCACGAAACCCTTCCGGTTCGA
GGAGCTGCTGGCCCGGATCCGGTTGCGGCTGCGCGACGACCGGGCCGCGGAGGTCACCGTGCTGGCCGCCGGGGAGCTGC
AGCTGGACCTGCTCAGCCGGACCGCCGCCGTCGCGGGGCGTTCCGTCGCCCTCTCCAGCCGGGAGTTCTCCCTCGCCGAG
GCGTTCCTGCGCCACCCCGGCCAGGTGCTCTCCCGCGAGCAGCTGCTCAGCTCGGTGTGGGGCTACGACTTCGACCCCGG
CTCCAACGTCGTCGACGTCTACGTGCGGTACCTGCGCAAGAAGCTCGGGGCCGGCCGCTTCGAGACGATCCGCGGCATGG
GCTACCGGCTCGTCGCGACCTGA

Protein sequence : 
MTSILIAEDETRIAAFVEKGLRANGYATTIATDGRTAHDLAGTGLFDLLILDIGLPVVDGFTVLRRLRAERHALPVIILT
ARDAVADTVAGLDGGADDYVTKPFRFEELLARIRLRLRDDRAAEVTVLAAGELQLDLLSRTAAVAGRSVALSSREFSLAE
AFLRHPGQVLSREQLLSSVWGYDFDPGSNVVDVYVRYLRKKLGAGRFETIRGMGYRLVAT

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 8e-24 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-23 41
armR AAN62112.1 putative response-regulator ArmR Not tested PAGI-2(C) Protein 2e-14 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Krad_2802 YP_001362536.1 winged helix family two component transcriptional regulator BAC0197 Protein 2e-26 47
Krad_2802 YP_001362536.1 winged helix family two component transcriptional regulator BAC0083 Protein 3e-30 45
Krad_2802 YP_001362536.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 2e-21 43
Krad_2802 YP_001362536.1 winged helix family two component transcriptional regulator BAC0111 Protein 3e-27 43
Krad_2802 YP_001362536.1 winged helix family two component transcriptional regulator BAC0125 Protein 3e-25 43
Krad_2802 YP_001362536.1 winged helix family two component transcriptional regulator BAC0308 Protein 2e-25 42
Krad_2802 YP_001362536.1 winged helix family two component transcriptional regulator NC_002516.2.879194.p Protein 3e-16 42
Krad_2802 YP_001362536.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 3e-23 41
Krad_2802 YP_001362536.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 3e-23 41
Krad_2802 YP_001362536.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 3e-23 41
Krad_2802 YP_001362536.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 3e-23 41
Krad_2802 YP_001362536.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 3e-23 41
Krad_2802 YP_001362536.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 3e-23 41
Krad_2802 YP_001362536.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 3e-23 41
Krad_2802 YP_001362536.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 3e-23 41
Krad_2802 YP_001362536.1 winged helix family two component transcriptional regulator BAC0638 Protein 3e-20 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Krad_2802 YP_001362536.1 winged helix family two component transcriptional regulator VFG0596 Protein 3e-24 43
Krad_2802 YP_001362536.1 winged helix family two component transcriptional regulator VFG1389 Protein 1e-28 41