Gene Information

Name : Krad_3311 (Krad_3311)
Accession : YP_001363039.1
Strain : Kineococcus radiotolerans SRS30216
Genome accession: NC_009664
Putative virulence/resistance : Resistance
Product : stress protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 3666980 - 3667555 bp
Length : 576 bp
Strand : +
Note : PFAM: stress protein; KEGG: fal:FRAAL5898 tellurium resistance protein TerE

DNA sequence :
ATGGGCGTCAGCCTCAGCAAGGGCGGCAACGTCTCCCTCACCAAGGAAGCGCCGGGGATGACCAAGGCCGTCATCGGCCT
GGGCTGGGACGCGAACTCCTTCACCGGCTCGGAGTTCGACCTCGACGCGCAGGCCATCATGGTCGGCGCGAACGGCAAGG
TCCCCAGTGACGGCTACTTCGTCTTCTTCAACCAGCTGAAGTCCCCCGAGGGCTCCGTGGAGCACACCGGCGACAACCGC
ACCGGTGAGGGCGACGGCGACGACGAGAAGATCAACGTCGACCTCAGCCTCGTGCCCGCCGAGATCGAGAAGATCGTCTT
CACCGTCGCCATCTACGACGCCGACACCCGCAAGCAGTCCTTCGGGCAGGTGCGCAACGGCTTCATCCGCGTGGTCAACA
GCGAGGGCGGCACCGAGGTCGCCCGCTACGACCTCACAGAGGACGCCTCCACCGAGACCGCGATGGTCTTCGGCGAGCTG
TACCGCAACGGGTCGGACTGGAAGTTCCGCGCCGTCGGCCAGGGCTACGCCGACGGTCTGCGCGGCATCGCGACCGACTT
CGGCGTCAGCGTCTGA

Protein sequence :
MGVSLSKGGNVSLTKEAPGMTKAVIGLGWDANSFTGSEFDLDAQAIMVGANGKVPSDGYFVFFNQLKSPEGSVEHTGDNR
TGEGDGDDEKINVDLSLVPAEIEKIVFTVAIYDADTRKQSFGQVRNGFIRVVNSEGGTEVARYDLTEDASTETAMVFGEL
YRNGSDWKFRAVGQGYADGLRGIATDFGVSV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 6e-59 65
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 5e-59 65
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 6e-59 65
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 5e-62 65
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 6e-60 63
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 6e-60 63
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 1e-59 63
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-54 59
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 7e-30 45
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-26 43
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 2e-26 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Krad_3311 YP_001363039.1 stress protein BAC0389 Protein 1e-59 63
Krad_3311 YP_001363039.1 stress protein BAC0390 Protein 5e-60 62
Krad_3311 YP_001363039.1 stress protein BAC0392 Protein 2e-26 43