Gene Information

Name : Krad_3620 (Krad_3620)
Accession : YP_001363347.1
Strain : Kineococcus radiotolerans SRS30216
Genome accession: NC_009664
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3308954 - 3309673 bp
Length : 720 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: art:Arth_0784 two component transcriptional regulator, winged helix family

DNA sequence :
GTGAGATCTGCGAGCTCCTCCCCGGAGGCCCGGCTGCTCGTCGTCGACGACGAGCCGAGCATCCGCGAACTGCTGGCCAC
CAGCCTCCGCTTCGCCGGCTTCGAGGTCGCCTCGGCCGGGGACGGCGCCGAGGCCCTGAAGCTGGCCGAGGACTTCCGCC
CCGACCTCGTGGTCCTCGACGTGATGCTCCCCGACGTCGACGGGTTCACCGTGACGCGCAAGCTGCGCGAGCGCGGGCGC
GCCGTCCCGGTCCTGTTCCTCACCGCCCGCGACGACACCGCCGACAAGGTCGCGGGCCTGACCGTCGGCGGCGACGACTA
CGTGACGAAGCCCTTCAGCCTGGAGGAGGTCGTGGCCCGCATCCGCGCGGTGCTGCGCCGCACCGGGGGCGTGGACGGGC
CGGACACCGGGCGGCTGGTGTTCCACGACCTGGAGCTGGAGGAGGACTCCCACGAGGTGCGCCGGGCCGGGCGGGAGGTG
GAGCTGTCGCCCACCGAGTTCAAGCTGCTGCGGTACCTGATGCTCAACCCCAACCGGGTGCTGTCGAAGGCGCAGATCCT
CGACCACGTGTGGGACTACGACTTCAACGGCGAGGCCGGGATCGTGGAGAGCTACATCTCCTACCTGCGCCGCAAGCTGG
ACACCGAGGGCCTGGAACCGCTCATCCACACCAAGCGCGGCGTGGGGTACGTCCTGCGGGTCGCGCAATCGGCGGGATGA

Protein sequence :
MRSASSSPEARLLVVDDEPSIRELLATSLRFAGFEVASAGDGAEALKLAEDFRPDLVVLDVMLPDVDGFTVTRKLRERGR
AVPVLFLTARDDTADKVAGLTVGGDDYVTKPFSLEEVVARIRAVLRRTGGVDGPDTGRLVFHDLELEEDSHEVRRAGREV
ELSPTEFKLLRYLMLNPNRVLSKAQILDHVWDYDFNGEAGIVESYISYLRRKLDTEGLEPLIHTKRGVGYVLRVAQSAG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
CDB402_0209 YP_005126722.1 two-component system response regulator Not tested Not named Protein 2e-28 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Krad_3620 YP_001363347.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 7e-33 47
Krad_3620 YP_001363347.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 8e-33 46
Krad_3620 YP_001363347.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 1e-32 46
Krad_3620 YP_001363347.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 1e-32 46
Krad_3620 YP_001363347.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 1e-32 46
Krad_3620 YP_001363347.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 1e-32 46
Krad_3620 YP_001363347.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 1e-32 46
Krad_3620 YP_001363347.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 1e-32 46
Krad_3620 YP_001363347.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 9e-33 46
Krad_3620 YP_001363347.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 1e-32 46
Krad_3620 YP_001363347.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 1e-32 46
Krad_3620 YP_001363347.1 winged helix family two component transcriptional regulator BAC0197 Protein 3e-33 45
Krad_3620 YP_001363347.1 winged helix family two component transcriptional regulator BAC0083 Protein 2e-34 43
Krad_3620 YP_001363347.1 winged helix family two component transcriptional regulator BAC0125 Protein 2e-32 43
Krad_3620 YP_001363347.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 5e-28 43
Krad_3620 YP_001363347.1 winged helix family two component transcriptional regulator BAC0638 Protein 2e-30 42
Krad_3620 YP_001363347.1 winged helix family two component transcriptional regulator AF162694.1.orf4.gene Protein 5e-25 41
Krad_3620 YP_001363347.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 9e-31 41
Krad_3620 YP_001363347.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 4e-33 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Krad_3620 YP_001363347.1 winged helix family two component transcriptional regulator VFG1386 Protein 6e-62 63
Krad_3620 YP_001363347.1 winged helix family two component transcriptional regulator VFG1390 Protein 2e-48 50
Krad_3620 YP_001363347.1 winged helix family two component transcriptional regulator VFG1389 Protein 5e-41 47