Gene Information

Name : Krad_3815 (Krad_3815)
Accession : YP_001363542.1
Strain : Kineococcus radiotolerans SRS30216
Genome accession: NC_009664
Putative virulence/resistance : Resistance
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3094067 - 3094744 bp
Length : 678 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: sco:SCO3013 two-component system response regulator

DNA sequence :
ATGAGGGGACGCGTCCTCGTGGTGGACGACGACACCGCGCTCGCCGAGATGCTGGGGATCGTGCTGCAGGGCGAGGGCCT
GGAGACCCGCTTCTGCGCCGACGGCGACCAGGCGGTCGGTGCCTTCCGGGCCACCCGGCCGGACCTGGTGCTGCTGGACC
TGATGCTGCCCGGGACCGACGGCATGGAGGTGTGCCGTCAGATCCGCGCCGAGTCCGGCGTGCCCATCGTCATGCTCACG
GCCAAGAGCGACACCGTCGACGTCGTCCTCGGCCTGGAGGCCGGCGCCGACGACTACGTCGTCAAGCCCTTCAAGCCCAA
GGAGCTCGTCGCCCGGGTCCGGGCCCGGTTGCGCTCGGCGGGGGAGCGGCCCCCGGAGACGCTGCGCATCGGCGACCTCA
CCATCGACGTCGCCGGGCACTCGGTGCGCCGCGACGGCCGCTCGCTGCCGCTGACGCCGCTGGAGTTCGAGCTGCTGGTG
ACCCTCGCCCGCAAGCCCTGGCAGGCGTTCACCCGCGAGCTGCTGCTGGAGCAGGTGTGGGGCTACCGCCACGCCGCCGA
CACCCGCCTCGTCAACGTCCACGTCCAGCGGCTGCGCTCGAAGATCGAGCGCGACCCCGAGCACCCCGAGATCGTCGTGA
CCGTCCGCGGGGTGGGGTACCGCGCCGGGCCGCTGTGA

Protein sequence :
MRGRVLVVDDDTALAEMLGIVLQGEGLETRFCADGDQAVGAFRATRPDLVLLDLMLPGTDGMEVCRQIRAESGVPIVMLT
AKSDTVDVVLGLEAGADDYVVKPFKPKELVARVRARLRSAGERPPETLRIGDLTIDVAGHSVRRDGRSLPLTPLEFELLV
TLARKPWQAFTRELLLEQVWGYRHAADTRLVNVHVQRLRSKIERDPEHPEIVVTVRGVGYRAGPL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
vanRB YP_008394254.1 DNA-binding response regulator VanRB Not tested Not named Protein 1e-29 41
vanRB NP_815956.1 DNA-binding response regulator VanRB Not tested Not named Protein 5e-29 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Krad_3815 YP_001363542.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 5e-75 72
Krad_3815 YP_001363542.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 2e-38 44
Krad_3815 YP_001363542.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 2e-38 44
Krad_3815 YP_001363542.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 2e-38 44
Krad_3815 YP_001363542.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 2e-38 44
Krad_3815 YP_001363542.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 2e-38 44
Krad_3815 YP_001363542.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 2e-38 44
Krad_3815 YP_001363542.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 2e-38 44
Krad_3815 YP_001363542.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 2e-38 44
Krad_3815 YP_001363542.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 2e-38 44
Krad_3815 YP_001363542.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 2e-38 44
Krad_3815 YP_001363542.1 winged helix family two component transcriptional regulator CP000034.1.gene2186. Protein 8e-34 44
Krad_3815 YP_001363542.1 winged helix family two component transcriptional regulator NC_002695.1.916589.p Protein 5e-34 44
Krad_3815 YP_001363542.1 winged helix family two component transcriptional regulator BAC0039 Protein 8e-34 44
Krad_3815 YP_001363542.1 winged helix family two component transcriptional regulator BAC0125 Protein 4e-28 43
Krad_3815 YP_001363542.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 3e-39 43
Krad_3815 YP_001363542.1 winged helix family two component transcriptional regulator BAC0596 Protein 8e-33 43
Krad_3815 YP_001363542.1 winged helix family two component transcriptional regulator CP001138.1.gene2239. Protein 8e-33 43
Krad_3815 YP_001363542.1 winged helix family two component transcriptional regulator CP001918.1.gene3444. Protein 1e-33 43
Krad_3815 YP_001363542.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 2e-37 42
Krad_3815 YP_001363542.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 2e-36 42
Krad_3815 YP_001363542.1 winged helix family two component transcriptional regulator CP000647.1.gene2531. Protein 4e-33 42
Krad_3815 YP_001363542.1 winged helix family two component transcriptional regulator AF310956.2.orf0.gene Protein 5e-30 41
Krad_3815 YP_001363542.1 winged helix family two component transcriptional regulator U35369.1.gene1.p01 Protein 2e-29 41
Krad_3815 YP_001363542.1 winged helix family two component transcriptional regulator AE016830.1.gene2255. Protein 2e-29 41
Krad_3815 YP_001363542.1 winged helix family two component transcriptional regulator BAC0197 Protein 4e-25 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Krad_3815 YP_001363542.1 winged helix family two component transcriptional regulator VFG1390 Protein 3e-30 43
Krad_3815 YP_001363542.1 winged helix family two component transcriptional regulator VFG1389 Protein 3e-24 43