Name : rpmJ (Krad_0284) Accession : YP_001360038.1 Strain : Kineococcus radiotolerans SRS30216 Genome accession: NC_009664 Putative virulence/resistance : Unknown Product : 50S ribosomal protein L36 Function : - COG functional category : - COG ID : - EC number : - Position : 2030603 - 2030725 bp Length : 123 bp Strand : + Note : smallest protein in the large subunit; similar to what is found with protein L31 and L33 several bacterial genomes contain paralogs which may be regulated by zinc; the protein from Thermus thermophilus has a zinc-binding motif and contains a bound zinc io DNA sequence : GTGAAGGTCCGCGCGTCCCTGAAGAGCCTCAAGCAGAAGGAGGGCTCCATCGTCGTCCGCCGCCGCGGGAAGACGTACGT CCTCAACAAGCGCAACCCCCGCTGGAAGGCGCGCCAGGGCTGA Protein sequence : MKVRASLKSLKQKEGSIVVRRRGKTYVLNKRNPRWKARQG |
Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
rpmJ | YP_001800879.1 | 50S ribosomal protein L36 | Not tested | Not named | Protein | 3e-08 | 70 |