
|
Name : rpmG (Krad_0286) Accession : YP_001360040.1 Strain : Kineococcus radiotolerans SRS30216 Genome accession: NC_009664 Putative virulence/resistance : Unknown Product : 50S ribosomal protein L33 Function : - COG functional category : J : Translation, ribosomal structure and biogenesis COG ID : COG0267 EC number : - Position : 2030113 - 2030280 bp Length : 168 bp Strand : + Note : in Escherichia coli BM108, a mutation that results in lack of L33 synthesis had no effect on ribosome synthesis or function; there are paralogous genes in several bacterial genomes, and a CXXC motif for zinc binding and an upstream regulation region of th DNA sequence : ATGGCGAAGTCCCAGGACGTCCGCCCCGTCATCAAGCTCCGCTCCACCGGGGGCACCGGGTACACCTACGTCACCCGCAA GAACCGCCGCAACGACCCCGACCGCATGGTCGTCCGCAAGTACGACCCCGTGCTGCGCCGGCACGTCGACTTCCGAGAGG AGCGCTGA Protein sequence : MAKSQDVRPVIKLRSTGGTGYTYVTRKNRRNDPDRMVVRKYDPVLRRHVDFREER |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| rpmG | NP_814353.1 | 50S ribosomal protein L33 | Not tested | Not named | Protein | 3e-04 | 41 |
| ef0106 | AAM75309.1 | EF0106 | Not tested | Not named | Protein | 2e-04 | 41 |