Gene Information

Name : merP (mma_1751)
Accession : YP_001353441.1
Strain : Janthinobacterium sp. Marseille
Genome accession: NC_009659
Putative virulence/resistance : Resistance
Product : mercuric transport periplasmic binding protein
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG2608
EC number : -
Position : 1984176 - 1984451 bp
Length : 276 bp
Strand : -
Note : -

DNA sequence :
ATGAAAAAGCTGTTTGCCTCCCTCGCTCTCGCCGCTTTCGTTGCCCCCGTGTTCGCCGCCACTCAGACCGTCACGCTGTC
CGTGCCTGGCATGACCTGCGCCTCTTGCCCGATCACTGTCAAGCACGCGCTTTCCAAGGTTGAGGGCGTGAGCAAGACCG
ACGTAAGTTTCGACAAGCGCCAGGCCGTCGTCACCTTCGACGATGCCAAGACCAACGTCCAGAAGTTGACCAAGGCGACC
GAGGACGCGGGCTATCCGTCCAGCCTCAAACGCTGA

Protein sequence :
MKKLFASLALAAFVAPVFAATQTVTLSVPGMTCASCPITVKHALSKVEGVSKTDVSFDKRQAVVTFDDAKTNVQKLTKAT
EDAGYPSSLKR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merP CAJ77062.1 Periplasmic mercuric ion binding protein Not tested AbaR1 Protein 1e-25 100
merP ACN81007.1 MerP periplasmic mercuric ion binding protein Not tested AbaR5 Protein 2e-25 100
merP AFG30122.1 MerP Not tested PAGI-2 Protein 9e-22 81
merP AGK07023.1 MerP Not tested SGI1 Protein 9e-22 81
merP AGK07081.1 MerP Not tested SGI1 Protein 9e-22 81
merP YP_006098389.1 mercuric ion transport protein Not tested Tn2411 Protein 1e-21 81
merP ABQ57373.1 MerP Not tested SGI1 Protein 9e-22 81
merP AET25399.1 MerP Not tested PAGI-2(C) Protein 9e-22 81
unnamed ABR13399.1 copper-transporting ATPase 2 Not tested PAGI-5 Protein 1e-21 78

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
merP YP_001353441.1 mercuric transport periplasmic binding protein BAC0679 Protein 3e-22 84
merP YP_001353441.1 mercuric transport periplasmic binding protein BAC0678 Protein 8e-22 82
merP YP_001353441.1 mercuric transport periplasmic binding protein BAC0231 Protein 5e-22 81
merP YP_001353441.1 mercuric transport periplasmic binding protein BAC0675 Protein 3e-20 75
merP YP_001353441.1 mercuric transport periplasmic binding protein BAC0674 Protein 2e-15 60