Gene Information

Name : merR3 (PSPA7_0094)
Accession : YP_001345490.1
Strain : Pseudomonas aeruginosa PA7
Genome accession: NC_009656
Putative virulence/resistance : Resistance
Product : Hg(II)-responsive transcriptional regulator
Function : -
COG functional category : K : Transcription
COG ID : COG0789
EC number : -
Position : 105066 - 105476 bp
Length : 411 bp
Strand : +
Note : Annotation was generated automatically without manual curation; identified by match to protein family HMM PF00376; match to protein family HMM PF09278; match to protein family HMM TIGR02051

DNA sequence :
ATGCACAACGCGGTGGAAAGCCTGACCATCGGCGCCTTTGCCAAGGCAGCCGGGGTTAACGTGGAAACCATTCGGTTCTA
TCAACGCAAGGGGCTGTTACCCGAACCGGACAAGCCCTACGGCAGCATTCGCCGCTATGGCGAGGCGGATGTCGCACGGG
TGAGATTCGTGAAGTCCGCGCAACGGCTGGGCTTTAGCCTTGATGAAGTGGCCGGACTGTTGCGACTGGACGACGGCGCG
CACTGCGACGAAGCGCGTGTGCTCGCCGAGCAGAAGCTTGAGGATGTGCGTGAGAAACTCGCGGATCTTCAGCGGATCGA
GTCGGTCTTGGCGCAGCTGGTTGATGACTGTTGCGCGAGCCAAGGGACAGTGAGCTGTCCGCTGATCGTTTCGCTGCAAG
CGAGCAAGTGA

Protein sequence :
MHNAVESLTIGAFAKAAGVNVETIRFYQRKGLLPEPDKPYGSIRRYGEADVARVRFVKSAQRLGFSLDEVAGLLRLDDGA
HCDEARVLAEQKLEDVREKLADLQRIESVLAQLVDDCCASQGTVSCPLIVSLQASK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ABR13397.1 mercuric resistance operon regulatory protein Not tested PAGI-5 Protein 6e-59 100
merR ACK44535.1 MerR Not tested SGI1 Protein 2e-47 78
merR AET25401.1 MerR Not tested PAGI-2(C) Protein 2e-47 78
merR AFG30124.1 MerR Not tested PAGI-2 Protein 2e-47 78
merR YP_006098391.1 mercuric resistance operon transcriptional regulator Not tested Tn2411 Protein 2e-47 78
merR CAJ77064.1 Mercury resistance operon regulatory protein Not tested AbaR1 Protein 4e-48 78
merR ACN81009.1 MerR activator/repressor of mer operon Not tested AbaR5 Protein 6e-48 78
merR AGK07025.1 MerR Not tested SGI1 Protein 7e-47 77
merR AGK07083.1 MerR Not tested SGI1 Protein 7e-47 77
merR AAN62181.1 organomercurial resistance regulatory protein MerR Not tested PAGI-2(C) Protein 4e-43 70
EXB37 ABD94723.1 putative regulator of mercury resistance conferring proteins Not tested ExoU island B Protein 7e-28 50

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
merR3 YP_001345490.1 Hg(II)-responsive transcriptional regulator BAC0684 Protein 2e-49 78
merR3 YP_001345490.1 Hg(II)-responsive transcriptional regulator BAC0683 Protein 2e-49 78
merR3 YP_001345490.1 Hg(II)-responsive transcriptional regulator BAC0686 Protein 2e-50 78
merR3 YP_001345490.1 Hg(II)-responsive transcriptional regulator BAC0232 Protein 4e-48 78
merR3 YP_001345490.1 Hg(II)-responsive transcriptional regulator BAC0687 Protein 4e-48 78
merR3 YP_001345490.1 Hg(II)-responsive transcriptional regulator BAC0688 Protein 4e-49 77
merR3 YP_001345490.1 Hg(II)-responsive transcriptional regulator BAC0689 Protein 1e-46 75