Gene Information

Name : PSPA7_6037 (PSPA7_6037)
Accession : YP_001351353.1
Strain : Pseudomonas aeruginosa PA7
Genome accession: NC_009656
Putative virulence/resistance : Unknown
Product : hypothetical protein
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG2963
EC number : -
Position : 6230737 - 6231045 bp
Length : 309 bp
Strand : -
Note : Annotation generated by automatically transferring the annotation from the manually curated GenBank accession AE004091; identified by match to protein family HMM PF01527

DNA sequence :
ATGACCAAGCAACGTCGTTCCTTTACGCCCGAGTTCAAACGAGAGGCCGCCTGCCTGGTGCTCGATCAGGGCTACAGCCA
TATCGAAGCAGCTCGTTCACTGGGAGTGGTTGAGTCGGCCCTGCGCCGATGGGTAAAACAGCTTCAAGAGGAGCGCGTGG
GCGTTACCCCGAAGAGCAAAGCACTGACGCCCGAACAGCAGAAAATCCAGGAGCTGGAAGCCAGGATCGACCGACTGGAA
CGGGAGAAAGCGATCCTAAAAAAGGCTACCGCTCTCTTGATGTCGGACGAGTTCAATCGTACGCGCTGA

Protein sequence :
MTKQRRSFTPEFKREAACLVLDQGYSHIEAARSLGVVESALRRWVKQLQEERVGVTPKSKALTPEQQKIQELEARIDRLE
REKAILKKATALLMSDEFNRTR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
RS05 AAP82950.1 putative transposase Not tested PAPI-2 Protein 1e-37 87
unnamed CAD42034.1 hypothetical protein Not tested PAI II 536 Protein 4e-21 59
orfA ACX47959.1 IS1359 transposase; OrfA Not tested SGI1 Protein 4e-21 57
VPI2_0009c ACA01826.1 transposase OrfAB subunit A Not tested VPI-2 Protein 4e-21 57
orfA AGK06911.1 IS1359 transposase; OrfA Not tested SGI1 Protein 4e-21 57
unnamed AGK06948.1 IS1359 transposase; OrfA Not tested SGI1 Protein 4e-21 57
orfA AGK06994.1 IS1359 transposase; OrfA Not tested SGI1 Protein 4e-21 57
orfA AGK07052.1 IS1359 transposase; OrfA Not tested SGI1 Protein 4e-21 57
VC1790 NP_231425.1 transposase OrfAB subunit A Not tested VPI-2 Protein 6e-21 57
orfA YP_001217330.1 transposase OrfAB subunit A Not tested VPI-2 Protein 6e-21 57
l7045 CAD33744.1 - Not tested PAI I 536 Protein 5e-22 54
orfA CAE85179.1 OrfA protein, IS911 Not tested PAI V 536 Protein 5e-22 54
insN YP_002152325.1 transposase for insertion sequence element IS911 Not tested Not named Protein 1e-21 54
api80 CAF28554.1 putative transposase Not tested YAPI Protein 5e-18 53
ECO111_3778 YP_003236113.1 putative IS602 transposase OrfA Not tested LEE Protein 8e-21 51
aec66 AAW51749.1 Aec66 Not tested AGI-3 Protein 5e-21 51
unnamed ACU09431.1 IS911 transposase orfA Not tested LEE Protein 2e-19 50
Z5088 NP_290240.1 hypothetical protein Not tested LEE Protein 2e-19 50
ECs4535 NP_312562.1 hypothetical protein Not tested LEE Protein 2e-19 50
unnamed AAC31483.1 L0004 Not tested LEE Protein 2e-19 50
trp1329A CAB46577.1 IS1329 transposase A Not tested HPI Protein 1e-14 43
tnpA CAB61575.1 transposase A Not tested HPI Protein 3e-14 42
unnamed CAD42047.1 hypothetical protein Not tested PAI II 536 Protein 1e-10 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
PSPA7_6037 YP_001351353.1 hypothetical protein VFG1553 Protein 2e-21 59
PSPA7_6037 YP_001351353.1 hypothetical protein VFG1123 Protein 2e-21 57
PSPA7_6037 YP_001351353.1 hypothetical protein VFG1485 Protein 2e-22 54
PSPA7_6037 YP_001351353.1 hypothetical protein VFG0784 Protein 7e-20 50
PSPA7_6037 YP_001351353.1 hypothetical protein VFG1566 Protein 4e-11 41